KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048714
Entry
101048714         CDS       T04350                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04210  Apoptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04926  Relaxin signaling pathway
sbq04931  Insulin resistance
sbq05132  Salmonella infection
sbq05134  Legionellosis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101048714 (NFKBIA)
   04668 TNF signaling pathway
    101048714 (NFKBIA)
   04024 cAMP signaling pathway
    101048714 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101048714 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101048714 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    101048714 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    101048714 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    101048714 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    101048714 (NFKBIA)
   04660 T cell receptor signaling pathway
    101048714 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    101048714 (NFKBIA)
   04659 Th17 cell differentiation
    101048714 (NFKBIA)
   04657 IL-17 signaling pathway
    101048714 (NFKBIA)
   04662 B cell receptor signaling pathway
    101048714 (NFKBIA)
   04062 Chemokine signaling pathway
    101048714 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101048714 (NFKBIA)
   04926 Relaxin signaling pathway
    101048714 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101048714 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101048714 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101048714 (NFKBIA)
   05203 Viral carcinogenesis
    101048714 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101048714 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101048714 (NFKBIA)
   05215 Prostate cancer
    101048714 (NFKBIA)
   05222 Small cell lung cancer
    101048714 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101048714 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101048714 (NFKBIA)
   05135 Yersinia infection
    101048714 (NFKBIA)
   05134 Legionellosis
    101048714 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101048714 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    101048714 (NFKBIA)
   05161 Hepatitis B
    101048714 (NFKBIA)
   05160 Hepatitis C
    101048714 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    101048714 (NFKBIA)
   05164 Influenza A
    101048714 (NFKBIA)
   05162 Measles
    101048714 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    101048714 (NFKBIA)
   05163 Human cytomegalovirus infection
    101048714 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101048714 (NFKBIA)
   05169 Epstein-Barr virus infection
    101048714 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101048714 (NFKBIA)
   05140 Leishmaniasis
    101048714 (NFKBIA)
   05142 Chagas disease
    101048714 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101048714 (NFKBIA)
   04131 Membrane trafficking [BR:sbq04131]
    101048714 (NFKBIA)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    101048714 (NFKBIA)
Membrane trafficking [BR:sbq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101048714 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 101048714
NCBI-ProteinID: XP_003924252
UniProt: A0A2K6SVU9
LinkDB
Position
Unknown
AA seq 310 aa
MFQAAEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAPQGAE
PWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDVAFLNFQNNLQQTPLHLAVITNQP
EIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQACTTPHLHSILKATNYNGH
TCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVN
RVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDD
CVFAGQRLTL
NT seq 933 nt   +upstreamnt  +downstreamnt
atgttccaggcagccgagtgggccatggagggcccccgcgatgggctgaagaaggagcgg
ctgctggacgaccgccacgacagcggcctggattctatgaaggacgaggagtacgagcag
atggtcaaggagctgcgggagatccgtcttgagccgcaggaggcgccgcagggcgccgag
ccctggaagcagcagctcaccgaggacggggactcgttcctgcatttggccattatccat
gaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagacgtggccttcctc
aacttccagaacaacctgcagcagactccactccacttggctgtgatcaccaaccagcca
gaaattgctgaggcacttctgggagctggctgtgatcctgagctccgagactttcgagga
aatacccccctacaccttgcctgtgagcagggctgcctggccagtgtgggagtcctgact
caggcctgcaccaccccgcacctccactccatcctgaaggctaccaactacaatggccac
acgtgtctgcacttagcttctatccatggctacctgggcatcgtggagcttttagtgtcc
ttgggtgctgatgtcaatgctcaggagccctgtaatggccggactgcccttcacctcgca
gtggacctgcagaatcctgacctggtgtcactcctgctgaagtgtggggctgatgtcaac
agagttacctatcagggctactccccttaccagcttacctggggccgtccaagcacccgg
atacagcagcagctgggtcagctgacactagaaaaccttcagatgctgccagagagtgag
gatgaggagagctacgacacagagtcagaattcacggaggatgagctcccctatgatgac
tgtgtgtttgcaggccagcgtctgacattatga

DBGET integrated database retrieval system