KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049021
Entry
101049021         CDS       T04350                                 

Gene name
AQP7
Definition
(RefSeq) aquaporin-7 isoform X1
  KO
K08771  aquaporin-7
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101049021 (AQP7)
   03320 PPAR signaling pathway
    101049021 (AQP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101049021 (AQP7)
Transporters [BR:sbq02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    101049021 (AQP7)
SSDB
Motif
Pfam: MIP aGPT-Pplase1
Other DBs
NCBI-GeneID: 101049021
NCBI-ProteinID: XP_003939791
UniProt: A0A2K6TE10
LinkDB
Position
Unknown
AA seq 342 aa
MIHASKHRRSTRSSKMVSWSGITRTQQILQKKLVREFLAEFMSTYVMMVFGLGSVAHMVL
SKTHGSYLAVNLAFGFGVTMGVHVAGNISGAHMNAAVTFANCALGRLPWRKFPVYVLGQC
LGSFLAAATIYALFYTAILHFSGGQLMVTGPVATAGIFATYLPDYMTLWWGFLNEVWLTG
MLQLCLFAITDQENNPALPGTQALVIGILVVTIGMSLGMNTGYAINPSRDLPPRIFTFIA
GWGKQVFSDGENWWWVPVVAPPLGAYLGGIIYVVFIGSTIPREPPKVEDSVAYEDHRITV
LSKMEPHASMASPLTPVSVSPDNRPAVRLAPTLQESMAQEHF
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgattcacgcatccaagcacaggcggtccacccgcagctccaaaatggtctcctggtct
gggataacaaggacacagcaaatactgcagaagaagttggtgcgagagttcctggccgag
ttcatgagcacatatgtcatgatggtgtttggccttggttccgtggcccatatggttcta
agtaaaacacatgggagctaccttgctgtcaacttggcttttggcttcggtgtcaccatg
ggagtgcatgtggcaggcaacatctctggggcccacatgaatgcagctgtgaccttcgct
aactgcgcactgggccgcctgccctggaggaagtttccggtctacgtgctgggtcagtgc
ctcggctccttcctggcggctgccaccatctacgccctcttctacacggccattctacac
ttttcgggtggacagctgatggtgaccggacccgtagcgacggctggcatttttgccacc
taccttcctgattacatgacattgtggtggggcttcctgaatgaggtgtggctgactggg
atgctccagctgtgtctcttcgccatcacggaccaggagaacaacccagcactgccgggc
acacaggcgctggtgataggcatacttgtggtcaccatcgggatgtcccttggcatgaac
acaggatatgccatcaacccatcccgggacctgcccccccgtatcttcaccttcattgcc
ggctggggcaaacaggtcttcagcgatggggagaactggtggtgggtgccagtggtggcg
ccacctctgggtgcctatctaggtggcatcatctatgtggtcttcattggctccaccatc
ccacgggagcccccaaaagtggaggactctgtggcgtatgaagatcacaggataaccgta
ttatccaagatggaacctcatgcatccatggcctctcccctcacccctgtctccgtgagc
cctgacaacagacctgcagtccgcctggcccccaccttacaggaatccatggcccaagaa
cacttctaa

DBGET integrated database retrieval system