KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049266
Entry
101049266         CDS       T04350                                 

Gene name
EHHADH
Definition
(RefSeq) peroxisomal bifunctional enzyme
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq00280  Valine, leucine and isoleucine degradation
sbq00310  Lysine degradation
sbq00380  Tryptophan metabolism
sbq00410  beta-Alanine metabolism
sbq00640  Propanoate metabolism
sbq00650  Butanoate metabolism
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
Module
sbq_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
sbq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101049266 (EHHADH)
   00650 Butanoate metabolism
    101049266 (EHHADH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101049266 (EHHADH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101049266 (EHHADH)
   00310 Lysine degradation
    101049266 (EHHADH)
   00380 Tryptophan metabolism
    101049266 (EHHADH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101049266 (EHHADH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101049266 (EHHADH)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101049266 (EHHADH)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     101049266 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101049266 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     101049266 (EHHADH)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 Peptidase_S49 TrkA_N 2-Hacid_dh_C ApbA F420_oxidored
Other DBs
NCBI-GeneID: 101049266
NCBI-ProteinID: XP_010335970
UniProt: A0A2K6TS73
LinkDB
Position
Unknown
AA seq 723 aa
MAEYTRLHNALALIRFRNPPVNAISMALLREIEEGLQKAVTDHTIKAIVICGAEGKFSAG
ADIHGFSAPRTLGLSLGSVVDEIQRNVKPVVAAIQGMALGGGLELALGCHYRIAHAEAQV
GLPEVTLGLVPGARGTQLLPRLIGVPAALDLITTGRYILAGEALKLGILDKVVNSDPLEE
AIRFAQRVSDQPLESRRLFNKPIPSLPNMDTIFSEALLKMRKQHPGCLAQEACVRAVQAA
VQYPYEVGSKKEEELFQYLLQSGQARALQYAFLAERKANKWSSPSGASWKTASAQPISSV
GVVGLGTMGRGIVISFARAGIPVIAVDSDKNQLATANKIITSVLEKEASKMQQSGHAWSG
PKPRLTSSMKELGGVDLVIEAVFEDMSLKKQVFAELSAVCKPEAFLCTNTSALDVDELAS
STSRPHLVIGTHFFSPAHIMKLLEVIPSRYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLNPYYNQTYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLT
GPTLPPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFL
SQYRETHHIEPRIISRDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHR
GGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGPPS
SKL
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggccgagtatacgcggctgcacaacgccttggcgctgatccgcttccgaaacccgccg
gtcaacgccatcagtatggctttactccgtgaaatagaagaaggactacagaaagctgta
acagaccatacaataaaagccattgtaatttgtggagcagagggcaaattttctgcaggt
gctgatattcatggcttcagtgctcctaggacccttggcttatcactgggaagtgtagta
gatgaaatacagagaaatgtgaagcccgtggtggcagcaatccaagggatggctttagga
ggaggactagagctggccctgggctgtcactataggattgcccatgcagaggctcaagtt
ggcttaccagaagttacactgggacttgtgcctggtgcaagaggaacccagcttctccca
agactcatcggagttcctgctgcacttgacttaattaccacaggaagatatattttagca
ggtgaagcactcaagctgggcattctagataaagttgtgaactcagacccacttgaagaa
gcaatcagatttgctcagagagtttcagatcaacctttagaatcccgtagactcttcaac
aagccaattccgagcttgcccaacatggacaccatttttagtgaggccctcttgaagatg
cggaagcagcaccctgggtgtcttgctcaggaggcttgtgtccgagcagtccaggctgct
gtgcagtatccctatgaagtgggcagcaagaaggaggaggagctgtttcaataccttttg
caatcagggcaggcaagagccctgcaatatgctttcttagctgaaaggaaagcaaataag
tggtcatctccctccggagcatcgtggaaaacagcatcagcgcagcccatctcctcggtt
ggtgttgtcggcttgggaacaatgggccgaggcattgtcatttcttttgcaagggccggg
attcctgtgattgctgtagactcagacaaaaaccagctagcaactgcaaacaagataatt
acctctgtcttggaaaaagaagcatccaaaatgcaacagagtggccacgcttggtcagga
ccaaaacccaggttaacttcatctatgaaggagcttggtggtgtagatttagtcattgaa
gcagtgtttgaggacatgagcctgaagaagcaggtctttgctgaactctcagctgtgtgc
aaaccagaagcttttctgtgcaccaacacttcagccctggacgttgatgagcttgcttct
tccacaagtcgccctcacttggtcattggcactcacttcttttcaccagctcatatcatg
aagttgctagaggttattcccagccgatactcttcccccacgactattgccactgttatg
aacttatcaaaaaagattaaaaagattggggtcgtcgtaggcaactgttttggatttgtg
gggaatcgaatgttgaatccttattacaatcagacatatttcttattagaagaaggcagc
aagccagaggaagtagatcaggtgctggaagagtttggttttaaaatgggaccttttaga
gtgtccgatcttgctgggttggatgtaggctggaaatctagaaaggggcaaggtcttacc
ggacctacgttgcctccaggaactcctgcccgaaaaagaggcaataggagatactgccca
attcctgatgtgctctgtgaattaggacgatttggccagaagacaggtaagggctggtat
caatatgacaagccattgggtaggattcacaaacctgatccctggctttccacattccta
tcacagtatagagaaacccatcacattgaaccacgtatcatcagccgggatgagatcctg
gagcgctgcttatattcacttatcaatgaagccttccgtatcttgggagaagggattgct
gctagcccagagcacattgatgttgtctatttacatggatacggatggccaaggcacagg
ggcgggcccatgttctatgcttccacagttgggttgcccactgttctagagaagttgcag
aaatattacaggcagaaccctgatattccccaactggagcccagtgactatctaaaaaag
ctggcttctcagggaaaccctcccctgaaagaatggcaaagcttggcaggcccccccagc
agcaagttgtga

DBGET integrated database retrieval system