KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049298
Entry
101049298         CDS       T04350                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04062  Chemokine signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04218  Cellular senescence
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05134  Legionellosis
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05144  Malaria
sbq05146  Amoebiasis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05219  Bladder cancer
sbq05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101049298 (CXCL8)
   04072 Phospholipase D signaling pathway
    101049298 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101049298 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101049298 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101049298 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101049298 (CXCL8)
   04621 NOD-like receptor signaling pathway
    101049298 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    101049298 (CXCL8)
   04657 IL-17 signaling pathway
    101049298 (CXCL8)
   04062 Chemokine signaling pathway
    101049298 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101049298 (CXCL8)
   05202 Transcriptional misregulation in cancer
    101049298 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    101049298 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101049298 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101049298 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101049298 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101049298 (CXCL8)
   05135 Yersinia infection
    101049298 (CXCL8)
   05133 Pertussis
    101049298 (CXCL8)
   05134 Legionellosis
    101049298 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101049298 (CXCL8)
   05171 Coronavirus disease - COVID-19
    101049298 (CXCL8)
   05164 Influenza A
    101049298 (CXCL8)
   05163 Human cytomegalovirus infection
    101049298 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101049298 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101049298 (CXCL8)
   05144 Malaria
    101049298 (CXCL8)
   05142 Chagas disease
    101049298 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101049298 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101049298 (CXCL8)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Chemokines
   101049298 (CXCL8)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Chemokines
   101049298 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101049298
NCBI-ProteinID: XP_010340897
LinkDB
Position
Unknown
AA seq 101 aa
MTSKLVLALLAAFLLSAALCEGELMPRSGKELRCQCIKTYSTRFSPKFIKELRAIDSGPH
CANTEIIVRLVDGRKICLDPKEEWVQKLVQIFLKRVENQTP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggttctggctctcttggcagccttcctgctttctgcagctctgtgt
gaaggtgaacttatgccaaggagtggtaaagaactgagatgtcagtgcataaagacatac
tccacacgtttctcccccaaatttatcaaagaactgagagcgattgatagtggaccacac
tgcgccaatacagaaatcattgtaaggcttgttgacggaagaaagatttgtctggacccc
aaggaagagtgggtgcagaaacttgtgcagatatttttgaagagggttgagaatcaaacg
ccataa

DBGET integrated database retrieval system