KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049410
Entry
101049410         CDS       T04350                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq04911  Insulin secretion
sbq04919  Thyroid hormone signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
sbq04931  Insulin resistance
sbq04976  Bile secretion
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
sbq05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101049410 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101049410 (SLC2A1)
   04922 Glucagon signaling pathway
    101049410 (SLC2A1)
   04920 Adipocytokine signaling pathway
    101049410 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    101049410 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    101049410 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101049410 (SLC2A1)
   05230 Central carbon metabolism in cancer
    101049410 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101049410 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101049410 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101049410 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101049410 (SLC2A1)
Transporters [BR:sbq02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   101049410 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    101049410 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523
Other DBs
NCBI-GeneID: 101049410
NCBI-ProteinID: XP_003937015
UniProt: A0A2K6SME5
LinkDB
Position
Unknown
AA seq 480 aa
MLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWIHRYGESILPTTLTTLWSLSVAIF
SVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVY
CGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNEDLWPLLLSI
IFVPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMM
REKKVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPVYATIG
SGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQLPWMSYLSIVAI
FGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPY
VFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGNSQGDKTPEELFHPLGADSQV
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgctggccgtgggaggggcagtgctcggctccctgcagtttggctacaacactggagtc
atcaatgctccccagaaggtgatcgaggagttctacaaccagacatggatccaccgctac
ggggagagcatcctgcccaccacgctcaccacgctctggtccctctcggtggccatcttc
tctgttgggggcatgattggctccttctctgtgggccttttcgttaaccgctttggccgg
cggaattcaatgctgatgatgaacctgctggccttcgtgtctgccgtgctcatgggcttc
tcgaagctgggcaagtcctttgagatgctgatcctgggccgcttcatcattggcgtgtac
tgtggcctgaccacaggcttcgtgcccatgtatgtgggtgaagtgtcacccacagccctt
cgtggggccctgggcaccctgcaccagctgggcatcgttgtcggcatcctcatcgcccag
gtgttcggcctggactccatcatgggcaatgaggacctgtggcccctgctgctgagcatc
atcttcgtcccggccctgctgcagtgcatcgtgctgcccttctgccccgagagccctcgc
ttcctgctcatcaaccgcaacgaggagaaccgggccaagagtgtgctgaagaagctgcgc
gggacggctgacgtgacccatgacctgcaggagatgaaggaggagagtcggcagatgatg
cgggagaagaaggtcaccatcctggagctgttccgctcggccgcctaccgccagcccatc
ctcatcgccgtggtgctgcagctgtcccagcagctgtcaggcatcaatgctgtcttctat
tactccacaagcatcttcgagaaggcaggggtgcagcagcctgtgtacgccaccatcggc
tccggcatcgtcaacacggccttcaccgttgtgtcgctatttgtggtggagcgagcaggc
cggcggaccctgcacctcataggcctggctggcatggcgggttgtgccatactcatgacc
atcgcgctggcattgctggagcagctgccctggatgtcctatctgagcattgtggccatc
tttggcttcgtggccttctttgaagtgggtcccggccccatcccatggttcatcgtggct
gaactcttcagccagggtccacgtccagctgccattgctgttgcaggcttctccaactgg
acctcaaatttcattgtgggcatgtgcttccagtatgtggagcaactgtgtggtccctac
gtcttcattatcttcactgtgctcctggttctgttcttcatcttcacctacttcaaagtt
cctgagactaaaggccggaccttcgatgagattgcttccggcttccggcaggggggaaac
agccaaggtgacaagacacccgaagagctgttccatcctctgggggctgattcccaagtg
tga

DBGET integrated database retrieval system