KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049427
Entry
101049427         CDS       T04350                                 

Gene name
ANGPTL4
Definition
(RefSeq) angiopoietin-related protein 4
  KO
K08767  angiopoietin-like 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101049427 (ANGPTL4)
  09154 Digestive system
   04979 Cholesterol metabolism
    101049427 (ANGPTL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101049427 (ANGPTL4)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101049427 (ANGPTL4)
SSDB
Motif
Pfam: Fibrinogen_C DivIC SlyX Spc7 COG5 HeLo UPF0242 DUF892 LpxB Exonuc_VII_L
Other DBs
NCBI-GeneID: 101049427
NCBI-ProteinID: XP_010347970
UniProt: A0A2K6V8Y8
LinkDB
Position
Unknown
AA seq 362 aa
MRGTPTAGAALVLCAATAGLLSAQAGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAE
RTRGQLSALERRLSACGSACQGAKGSTALPLTPGSRVSSGEVDREVLHSLQTQLKAQNSR
IQQLFHKVAQQQRHLEKQHLRIQSLQSQVGLLAPTHLDSEVAKSARGKRLPKMAQPVDVA
HNASRLHRLPRDCQELFQNGERQSGLFEIQPQGSPPFLVNCNMTSDGGWTVIQRRHDGSV
DFNRPWEAYKAGFGDPQGEFWLGLEKVHSITGDHDSRLAVQMWDWDGNTELLQFPVHLGG
EDTAYSLQLTSSMAGQLGATAVPPSGLSVPFSTWDQDHDLRGDKNCAKSLSGILYRADLE
IL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcgcggtactccgacggccggagcagccctagtgctgtgcgctgccaccgctgggctg
ctgagcgctcaggccggccccgtgcagtccaagtcgccacgctttgcgtcctgggacgag
atgaatgtcctggcgcacggactcctgcagctcggccaggggttgcgggaacacgcggag
cgcacccgcggtcagctgagcgcgctggagcggcgcctgagcgcgtgcggttccgcctgc
cagggagccaaggggtccaccgcgctcccgttaacccccgggagccgggtctccagcggc
gaggtggaccgtgaggtccttcacagccttcagacacagctcaaggctcagaacagcagg
atccagcaactcttccacaaggtggcccagcagcagcggcacctggagaagcagcacctt
cggattcagagtctgcaaagccaggttggcctcctggcccccacgcacctagacagtgag
gtggccaagtctgcccgaggaaagaggctgcccaagatggcccagccagttgacgtggct
cacaatgctagccgcctgcaccggctgcccagggattgccaggagctgttccagaacggg
gagaggcagagtggactatttgagatccagcctcaggggtctccgccattcctggtgaac
tgcaatatgacctcagatggaggctggacagtaattcagaggcgccacgatggctctgtg
gacttcaaccggccctgggaagcctacaaggcaggattcggggatccccaaggtgagttc
tggctgggcctggagaaggtgcacagcatcacaggggaccatgacagccgcctggccgtg
cagatgtgggactgggatggcaacacggagttgctgcagtttcccgtgcacctgggtggt
gaggatacggcctatagcctgcagctcacctcgtccatggccggtcagctgggtgccacc
gccgtcccacccagtggcctctctgtgcccttctccacttgggaccaggatcatgacctc
cgcggggacaagaactgcgccaagagcctctctggcatcctgtacagagcagacttagag
attctctga

DBGET integrated database retrieval system