KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049631
Entry
101049631         CDS       T04350                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04140  Autophagy - animal
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq05010  Alzheimer disease
sbq05014  Amyotrophic lateral sclerosis
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05165  Human papillomavirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101049631 (BAD)
   04014 Ras signaling pathway
    101049631 (BAD)
   04370 VEGF signaling pathway
    101049631 (BAD)
   04024 cAMP signaling pathway
    101049631 (BAD)
   04022 cGMP-PKG signaling pathway
    101049631 (BAD)
   04151 PI3K-Akt signaling pathway
    101049631 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101049631 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    101049631 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101049631 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101049631 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101049631 (BAD)
   04919 Thyroid hormone signaling pathway
    101049631 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101049631 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101049631 (BAD)
   05203 Viral carcinogenesis
    101049631 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101049631 (BAD)
   05212 Pancreatic cancer
    101049631 (BAD)
   05225 Hepatocellular carcinoma
    101049631 (BAD)
   05221 Acute myeloid leukemia
    101049631 (BAD)
   05220 Chronic myeloid leukemia
    101049631 (BAD)
   05218 Melanoma
    101049631 (BAD)
   05211 Renal cell carcinoma
    101049631 (BAD)
   05215 Prostate cancer
    101049631 (BAD)
   05213 Endometrial cancer
    101049631 (BAD)
   05223 Non-small cell lung cancer
    101049631 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101049631 (BAD)
   05014 Amyotrophic lateral sclerosis
    101049631 (BAD)
   05020 Prion disease
    101049631 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    101049631 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101049631 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101049631 (BAD)
   05161 Hepatitis B
    101049631 (BAD)
   05160 Hepatitis C
    101049631 (BAD)
   05162 Measles
    101049631 (BAD)
   05168 Herpes simplex virus 1 infection
    101049631 (BAD)
   05165 Human papillomavirus infection
    101049631 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101049631 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101049631 (BAD)
   01524 Platinum drug resistance
    101049631 (BAD)
   01522 Endocrine resistance
    101049631 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 101049631
NCBI-ProteinID: XP_003937702
UniProt: A0A2K6TG62
LinkDB
Position
Unknown
AA seq 167 aa
MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSH
HGGAGAVETRSRHSSYPAGTEGDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagagg
ggcctgagccccagcaccgcaggggacagccccccaggctctggcaagcatcgacgccag
gccccaggcctcccgggggacgccagtcaccagcagggacagccaaccagcagcagccac
catggaggcgctggagccgtggagacacggagtcgccacagctcgtaccccgcagggacg
gagggggacgaagggatggaggaggagcccagcccttttcggggccgttcgcgctcggca
ccccccaacctctgggcagcacagcgatatggccgcgagctccggaggatgagtgacgag
tttgtggactccttcaagggacttcctcgcccgaagagcgcgggcacagcaacgcagatg
cggcaaagctccagctggacgcgagtcatccagtcctggtgggatcggaacttgggcagg
ggaggctccgctccctcccagtga

DBGET integrated database retrieval system