KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049706
Entry
101049706         CDS       T04350                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04015  Rap1 signaling pathway
sbq04371  Apelin signaling pathway
sbq04390  Hippo signaling pathway
sbq04514  Cell adhesion molecules
sbq04520  Adherens junction
sbq05100  Bacterial invasion of epithelial cells
sbq05200  Pathways in cancer
sbq05213  Endometrial cancer
sbq05216  Thyroid cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101049706 (CDH1)
   04390 Hippo signaling pathway
    101049706 (CDH1)
   04371 Apelin signaling pathway
    101049706 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101049706 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101049706 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101049706 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101049706 (CDH1)
   05216 Thyroid cancer
    101049706 (CDH1)
   05218 Melanoma
    101049706 (CDH1)
   05219 Bladder cancer
    101049706 (CDH1)
   05213 Endometrial cancer
    101049706 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101049706 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101049706 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:sbq04515]
    101049706 (CDH1)
   04090 CD molecules [BR:sbq04090]
    101049706 (CDH1)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101049706 (CDH1)
Cell adhesion molecules [BR:sbq04515]
 Cadherins
  Major cadherins
   101049706 (CDH1)
CD molecules [BR:sbq04090]
 Proteins
  101049706 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Cadherin_3 BACON_2
Other DBs
NCBI-GeneID: 101049706
NCBI-ProteinID: XP_010345147
LinkDB
Position
Unknown
AA seq 851 aa
MKLVVRRKALESESHSALLLLLLLQVSSRLCQEPEPCHPGFDSESYTFKVPRRHLERGRV
LGRVSFEDCTGQPRTAYFSVDTRFKVGTDGVITVKRPVQLHNPQIHFLVYAWDSTYRKFS
TKVTLQAVGHPHHPHHESVPGSHVEVLTFPDSSHGLRRQKRDWVIPPISCPENEKGPFPK
NLVQIKSNKDKEARVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDREQIATYTLFSH
AVSSNGNAIEDPMEIVITVTDQNDNRPEFTQEVFHGSVMEGALPGTSVMEVSATDADDDV
HTYNAAIAYTILSQAPELPYEKMFTINTNTGVISVLTTGLDRETFPTYTLVVQAADLQGV
GLSTTATAVITVTDANDNPPIFSPTTYQGQVPENEANFEITTLKVTDADAPNTPAWEAVY
TILNDNEGQFVVTTNPATNDGILKTAKGLDFEAKQQYILHVAVTNVAPFEVSLTTSTATV
IVDVVDVNEAPIFVPLEKKVTVSEDFGVGQEITSYTAREPDKFMEQKITYRIWRDTANWL
EINPDTGAISTRAELDRENSEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAP
IPEPRNLYFCKRNPEPQVINIIDADLPPNTSPFTAELTHGASANWTIEYNDPTQESLILK
PKIHLEVGEYKIHLKLMDNQNKDQVTTLEVHVCDCEGTASVCERAPYVGAGLQVPAILGI
LGGILALLSKFSWQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFI
DENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKK
LADMYGGGEDD
NT seq 2556 nt   +upstreamnt  +downstreamnt
atgaagctggttgttagacgaaaggccctggaatcagagagccactccgcgctgctgctg
ctgctgctgctgcaggtctcgtctaggctctgccaggagccggagccctgccacccgggc
tttgactccgagagctacacgttcaaggtgcctcggcggcatctggagagaggccgcgtc
ctgggcagagtgagttttgaagattgcactggccaaccaaggacagcctacttttccgtt
gacactcgattcaaagtgggcacggatggtgtgattacagtgaaaaggcctgtacaactt
cataacccacagatccattttctggtctacgcctgggactccacctacagaaagttttcc
accaaagtcacgctgcaggcagtggggcacccccaccacccccatcatgaatctgttccc
ggatcccatgtggaagtgctcacatttcccgactcctctcatggcctcagaagacagaag
agagactgggttatccctcccatcagctgcccagaaaatgaaaaaggcccatttcctaaa
aacctggttcagatcaaatccaacaaagacaaagaagccagggttttctacagcatcact
ggccaaggagctgacacaccccctgttggtgtctttattattgaaagagaaacaggatgg
ctgaaggtgacagagcctttggatagagaacaaattgccacatacactctcttctctcat
gctgtgtcatccaatgggaatgctattgaggacccaatggagattgtgataaccgtgacc
gatcagaatgacaacaggcccgagttcacccaggaagtctttcacgggtctgtcatggaa
ggcgctcttccaggaacctccgtgatggaggtctcagccacagacgcagacgatgatgtg
cacacctacaatgctgccatcgcttacaccatcctcagccaagcgcctgagctgccttat
gaaaagatgttcacaattaatacgaacacaggagtcatcagtgtgctcaccaccgggctg
gaccgagagactttccctacatataccctggtggttcaggctgctgaccttcaaggagtt
gggttaagcacaacagcaacagctgtgatcacagtcaccgatgccaacgataaccctccg
atcttcagtcccaccacgtaccagggtcaggtgcccgagaacgaggctaacttcgaaatc
accacactgaaagtgactgacgctgacgcccccaacactccagcgtgggaggctgtatac
accatattgaatgataatgaggggcaatttgtcgtcaccacaaatccagcgaccaatgat
ggcattttgaaaacagcaaagggcttggattttgaggccaaacaacagtacattctacat
gtggcagtgacaaacgtggccccatttgaggtctctctcaccacctccacagctactgtc
atcgtggatgtggtggatgtgaatgaagcccccatctttgtgcctcttgaaaagaaagtg
acagtgtctgaggactttggtgtgggccaggaaatcacatcctacactgcccgggagcca
gacaaatttatggaacagaaaataacgtatcggatttggagagacactgccaattggcta
gagattaatccggacactggtgccatttccactcgggctgagctggacagggagaactct
gagcatgtgaagaacagcacatacacagccctcatcatagctacagacaacggttctcca
gttgctactggaacggggacgcttctgctgatcctgtctgatgtgaatgacaatgccccc
ataccagaacctcgaaatttatacttctgcaagaggaatccagagcctcaagtcatcaat
atcattgatgcagaccttcctcccaatacatctcccttcacagcagaactaacacatggg
gcgagtgccaactggaccattgagtacaatgacccaacccaagaatctctcattttgaag
ccaaagatacacttagaggtgggcgagtacaaaatccatctcaagctcatggataaccag
aataaagaccaagtgaccaccttagaggttcacgtgtgtgactgtgaagggaccgccagc
gtctgtgaaagggcaccgtatgttggagcaggattgcaagttcctgccatcctggggatt
cttggaggaattcttgcattgctaagtaagttcagttggcaagactttgacttgagccag
ttgcacaggggcctggacgctcgacctgaagtgactcgtaacgatgtcgcgccaaccctc
atgagcgttccccggtaccttccccgccctgccaatcccgatgaaattggaaattttatt
gatgaaaatctgaaggcggctgatagtgaccccacggccccaccttatgattctctgctc
gtgtttgactatgaaggaagtggttccgaagctgctagtctgagctccctgaactcctcg
gagtcagacaaagaccaggactatgactacttgaacgaatggggcaatcgcttcaagaag
ctggcagacatgtacggaggcggcgaggatgactag

DBGET integrated database retrieval system