KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049716
Entry
101049716         CDS       T04350                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04621  NOD-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101049716
   04623 Cytosolic DNA-sensing pathway
    101049716
SSDB
Motif
Pfam: HIN PYRIN SprA-related
Other DBs
NCBI-GeneID: 101049716
NCBI-ProteinID: XP_010346824
LinkDB
Position
Unknown
AA seq 347 aa
MESKYKEILLLTGLENITNEELDRFKFFLPDEFNIARSKLHAANRPQLANLMIENAGVVS
AVTKTIRIFRKLNYMLLARRLQEEKEKVDKEYKSATKQKPLSQTEMSPAASAAIRNDVKK
QRAAPKVSAHIKPEQKQMVVQQESIREGFQKDHLPVMVLKAMKPFEFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRIIIISRYYRHSGFLEVTSASRVLDAKSDQKVNVPP
NIIRKAGETPKISTLQTQPLGTIVNGLFVVYKVTEKKKGILNLRDNTGDMEVLVAGDQDT
IKCEEGDKLRLTFFTLSKNGEKLQLTPGVHSTIKVGTAWSKVSAPRG
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagagtaaatataaggagatactcctgctaacgggcctggagaacatcaccaatgaa
gaactggatagatttaagttcttccttccagatgagtttaatattgctagaagcaaacta
catgctgcaaatcgaccacaactagctaacctgatgattgaaaatgctggtgtggtgtct
gcagtgacgaagaccattcgtatttttcggaagttgaattacatgcttttggcaagacgt
cttcaggaagagaaggagaaagttgataaggaatacaaatcagcaacaaaacaaaagcca
ctgagtcaaactgaaatgagtcctgctgcgtctgcagccatcagaaatgatgtcaaaaag
caacgggctgcaccaaaagtctctgctcatattaagcctgagcagaaacagatggtggtc
cagcaggaatctatcagagaagggtttcagaaagaccatttgccggttatggtactgaaa
gcaatgaagcccttcgagtttgagacccaagaaggcaagcaagagatgtttcatgctaca
gtggctacagagaaggaattcttctttgtaaaagtttttaatacactgctaaaagataaa
ttcattccaaagagaataattataatatcaagatattatcggcacagtggtttcttagaa
gtaactagtgcctcacgtgtgttagatgctaaatctgaccaaaaggttaatgtcccacca
aacattatcagaaaagctggggaaaccccaaagatcagcacgcttcaaactcagcccctc
ggaacaattgtgaatgggttgtttgtggtctataaggtaacagaaaagaagaaaggtata
ttaaacctaagggacaacactggcgatatggaagtactggtggctggagaccaggacaca
ataaaatgtgaggaaggagataagcttcgacttacattcttcacgctgtcaaaaaatgga
gaaaaactacagctgacacctggagtccatagcaccataaaggtgggaactgcatggagc
aaagtcagcgctccaaggggatga

DBGET integrated database retrieval system