KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049756
Entry
101049756         CDS       T04350                                 

Gene name
JUP
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05221  Acute myeloid leukemia
sbq05226  Gastric cancer
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101049756 (JUP)
   05202 Transcriptional misregulation in cancer
    101049756 (JUP)
  09162 Cancer: specific types
   05226 Gastric cancer
    101049756 (JUP)
   05221 Acute myeloid leukemia
    101049756 (JUP)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101049756 (JUP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101049756 (JUP)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101049756 (JUP)
SSDB
Motif
Pfam: Arm HEAT Cnd1 Adaptin_N Atx10homo_assoc HEAT_2 DUF3361 Arm_2 KAP PUL
Other DBs
NCBI-GeneID: 101049756
NCBI-ProteinID: XP_010328928
UniProt: A0A2K6S1H8
LinkDB
Position
Unknown
AA seq 745 aa
MEVINLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTAT
YTQGVPPSQGDLEYQMSTTARAKRVREAMCPGMSGEDSSLLLATQVEGQATNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLNQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANSGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HMAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYASMENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLDMHLDV
DGDYPIDTYSDGLRPPYPAADHMLA
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggaggtgataaatctgatggaacagcctatcaaggtgactgagtggcagcagacgtac
acctacgactcgggcatccactcaggcgccaacacctgcgtgccctctgtcagcagcaag
ggcatcatggaggaggacgaggcctgtgggcgccagtacactctcaagaagaccgccacc
tacacccaaggggtgcccccgagccaaggtgacctggagtaccagatgtccaccacagcc
agagccaagcgcgtgcgggaggccatgtgccctggcatgtcaggcgaggacagctcgttg
ctgctggccacccaggtggaggggcaggccaccaacctgcagcgactggctgagccgtcc
cagctgctcaagtcggccatcgtgcatctcatcaactaccaggacgacgcggagctggcc
acccgcgccctgcctgagctcaccaagctgctcaacgacgaggacccggtagtggttacc
aaggcggccatgattgtgaaccagctgtcgaagaaggaagcatcgcggcgggccctgatg
ggctctccccagctggtggcagctgtcgtgcgcaccatgcagaacaccagcgacctggac
acggcccgctgcacgaccagcatcctgcacaacctctcccaccaccgggaggggctgctc
gccatcttcaagtcgggcggcatccctgctctagtccgcatgctcagctcccctgtggag
tcggtcctgttctacgccatcaccacgctgcacaacctgctcctgaaccaggagggtgcc
aagatggcggtgcgcctggccgatgggctgcagaagatggtgcccctgctcaacaagaac
aaccccaagttcctggccatcaccaccgactgcctgcagctcctggcctacggcaaccag
gagagcaagctgatcatcctggccaatagtgggccccaggccctcgtgcagatcatgcgt
aactacagttatgagaagctgctctggaccaccagtcgcgtgctcaaggtgctgtctgtg
tgtcccagcaataagcctgccattgtcgaggccggtgggatgcaggcgctgggcaagcac
ctgaccagcaacagcccacgcctggtgcagaactgcctgtggaccctgcgcaacctctcg
gacgtggccaccaagcaggagggcctggagagcgtgctgaagattctggtgaatcagctg
agcgtggatgacgtcaacgtgctcacctgtgccacgggcacgctgtccaacctcacatgc
aacaacagcaagaacaagacgctagtgacacagaacagcggagtggaggctctcatccac
gccatcctgcgcgcgggtgacaaggacgacatcacagagcctgccgtctgcgccctgcgc
catctcactagccgccatcccgaggccgagatggcccagaactctgtgcgtctcaactat
ggcatcccggccatcgtgaagctgctcaaccagcccaaccagtggccgctggtcaaggca
accatcggcttgatcaggaatctggccctgtgcccagccaaccatgcccccctgcaggag
gcagcggtcatcccccgcctggtccaactgctggtcaaggctcaccaggatgctcagcgt
cacatggctgcaggcacacagcagccctacacggacggtgtgaggatggaggagattgtg
gagggctgcaccggagccctgcacatcctcgcccgggaccccatgaaccgcatggagatc
ttccggctcaacaccatccccctgtttgtacagctcctgtacgcatcaatggagaacatc
cagcgtgtggccgctggggtgctgtgtgagctggcccaggacaaggaggcggcggatgcc
attgatgcagagggggcctcggccccactcatggaattgctgcattcccgcaacgagggc
actgccacctacgctgctgccgtcctgttccgcatctccgaggataagaacccagactac
cggaagcgtgtgtcggtggagctcaccaactccctcttcaagcatgacccagctgcctgg
gaggctgcccagagcatgatccctatcaatgaaccctatggagatgacatggatgccacc
taccgtcccatgtactccagtgatgtgccccttgaccccctggacatgcacttggacgtg
gacggagactaccccatcgacacctacagcgacggcctcaggcccccgtaccctgctgca
gaccacatgctggcctag

DBGET integrated database retrieval system