KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049918
Entry
101049918         CDS       T04350                                 

Gene name
TLR3
Definition
(RefSeq) toll-like receptor 3
  KO
K05401  toll-like receptor 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101049918 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101049918 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    101049918 (TLR3)
   05160 Hepatitis C
    101049918 (TLR3)
   05171 Coronavirus disease - COVID-19
    101049918 (TLR3)
   05164 Influenza A
    101049918 (TLR3)
   05168 Herpes simplex virus 1 infection
    101049918 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101049918 (TLR3)
   05165 Human papillomavirus infection
    101049918 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:sbq04054]
    101049918 (TLR3)
   04090 CD molecules [BR:sbq04090]
    101049918 (TLR3)
Pattern recognition receptors [BR:sbq04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   101049918 (TLR3)
CD molecules [BR:sbq04090]
 Proteins
  101049918 (TLR3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR LRR_6 LRR_9 TIR_2 LRRNT LRRCT
Other DBs
NCBI-GeneID: 101049918
NCBI-ProteinID: XP_003933874
UniProt: A0A2K6TZX6
LinkDB
Position
Unknown
AA seq 904 aa
MRQTLPYIYFWGGLLPFGMLCVSSANKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTH
NQLRRLPAANFTRYSQLTILDVGFNTISKLEPELCQKLPMLKVWNLQHNELSQLSDKTFV
FCTNLTELHLMSNSIQKIKNDPFKNQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSN
NKIQALKSEELDFLANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEK
LCLELANTSVRSLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSHNNLNVVGNDSFAWLPHL
EYFFLEYNNIQHLFSHSLHGLFSVRYLNLKRSFSKQSTSLDSLPKIDDFSFQWLKCLEHL
NMDDNDIPGIKSNMFTGLINLKYLGLSNSFTSLRTLTNETFVSLAHSPLHLLNLTKNKIS
KIESGAFSWLGHLQVLDLGLNEIGQELTGQEWRGLEEIFEIYLSYNKYLQLTRNSFALVP
SLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDTLDGLEKLEILDLQHN
NLARLWKHANPGGPVYFLKGLSHLHILNLESNGFDEIPVEVFKDLSELKIIDLGLNNLNI
LPASVFDNQVSLKSLNLQKNLITSVEKKVFGPAFRNLRDLDMRFNPFDCTCESIAWFVNW
INETHTNIPELSSRYLCNTPPHYHGFPVGLFDTASCKDSAPFELFFIISTSILLIFIFMV
LVIHFEGWRITFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAQKDKDWVWEHFSPMEEE
DKSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI
EQNLDSIILIFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERISAFHHKLRVALGSK
NSVH
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgagacagactttgccttacatctacttttgggggggacttttgccctttgggatgctg
tgtgtatcctctgccaacaaatgcactgttagccatgaagttgctgactgcagccatctg
aagttgactcaggtacccgatgacctccccacaaacataacagtgttgaatcttacccat
aatcaactcagaagactaccggcggccaattttacaaggtatagccagctaactatcttg
gatgtaggatttaacaccatctcaaaactggagccagaattgtgccaaaaacttcccatg
ctaaaagtttggaacctccagcacaatgagctgtctcaactttctgataaaacttttgtc
ttctgcacgaatttgactgaactccacctcatgtccaactcaatccagaaaattaaaaat
gatccctttaaaaaccagaagaatttaatcacattagatctgtctcataatggcttgtca
tctacaaaattaggaactcaggttcagctggaaaatctccaagagcttctattatcaaac
aataaaatccaagcactgaaaagcgaagaacttgatttcctcgccaattcatctttaaaa
aagttagagttgtcatcaaatcaaattaaagagttttccccagggtgttttcatgcaatt
ggaagattattcggcctctttctcaacaatgtccagctgggtcccagcctcacagagaag
ctatgtttggaattagcaaacacaagcgttcggagtctgtctctgagtaacagccagctg
tccaccaccagcaacacaactttcttgggtctgaagtggacaaatctcaccatgctggat
ctgtcccacaacaacttaaatgtagttggtaacgattcctttgcgtggctgccacatcta
gagtatttcttcctggagtataacaacatacagcatttgttctctcactctttgcacggg
cttttcagtgtgcggtacctgaatttgaaacggtctttttctaaacaaagtacttccctt
gattcgctccccaagattgatgatttttcctttcagtggctaaaatgtttggaacatctt
aacatggacgataatgatattccaggcatcaaaagcaatatgttcacaggattgataaac
ctgaaatacttgggtctatccaactcctttacaagtttgcggactttgacaaacgaaacc
tttgtatcacttgctcattctcccctacacctactcaacctaaccaagaataaaatctca
aaaatagagagtggtgctttctcttggttgggtcacctacaagtacttgacctgggcctt
aatgaaattgggcaagaactcacaggccaggaatggagaggtctagaagaaatttttgaa
atctatctttcctacaataagtacctgcaactgactaggaactcctttgccctggtccca
agccttcaacgactgatgctccgaagggtagcccttaaaaatgtggatagttctccttcg
ccgttccagcctcttcggaacttgaccattctggacctaagcaacaataacatagccaac
atcaacgatgacacgttggacggtcttgagaaactggaaattctggatttgcagcataac
aacttagcccggctctggaaacatgcaaaccctggtggtcctgtttattttctaaagggt
ctgtcccatctccacatccttaacttggagtctaacggctttgacgagatccccgttgag
gtcttcaaggatttatctgaactaaagatcatcgatttaggattgaataatttaaacata
cttccagcttctgtctttgataatcaggtgtctctaaagtcactgaaccttcagaagaat
ctcataacatcagtggagaagaaggttttcgggccagctttcaggaacctgcgtgattta
gacatgcgttttaatccctttgattgcacgtgtgagagcatcgcctggtttgttaattgg
attaatgagacccataccaacatccctgagctgtcaagccgctacctctgcaatacgccg
cctcactatcacgggttcccagtggggctttttgatacagcatcctgcaaagacagtgcc
ccttttgaactctttttcataatcagtaccagtatcctattgatttttatctttatggta
cttgtcatccactttgagggctggaggataactttttactggaatgtttcagtacatcga
gttcttggtttcaaagaaatagacagacagacagaacagtttgaatatgcggcatatata
attcatgcccaaaaagacaaggattgggtctgggaacacttttccccaatggaagaggaa
gacaaatctctcaaattttgtctggaagaaagggactttgaggcaggtgttttcgaactg
gaagcaattgttaacagcatcaaaagaagcagaaaaattattttcgttataacacaccat
ctattaaaagacccgttatgcaaaagattcaaggtacatcatgcagttcaacaagctatt
gaacaaaatctagattccattatactgattttccttgaggagattccagattataaactg
aaccatgcactctgcttgcgaagaggaatgtttaaatctcactgcatcttgaactggccg
gttcagaaagaacggatcagcgcctttcatcataaattgcgagtagcactgggatccaaa
aactcagtacattaa

DBGET integrated database retrieval system