KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050033
Entry
101050033         CDS       T04350                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00561  Glycerolipid metabolism
sbq03320  PPAR signaling pathway
sbq04979  Cholesterol metabolism
sbq05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101050033 (LPL)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101050033 (LPL)
  09154 Digestive system
   04979 Cholesterol metabolism
    101050033 (LPL)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101050033 (LPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101050033 (LPL)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101050033 (LPL)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sbq00537]
    101050033 (LPL)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101050033 (LPL)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101050033 (LPL)
  Exosomal proteins of breast milk
   101050033 (LPL)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Enzymes
   101050033 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sbq00537]
 Enzymes
  101050033 (LPL)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1 NAGLU
Other DBs
NCBI-GeneID: 101050033
NCBI-ProteinID: XP_003935632
UniProt: A0A2K6T9R8
LinkDB
Position
Unknown
AA seq 475 aa
MESKALLLLALAVCLQSLTASRGGVAAADHRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTKSETQTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWNSDSYFSWSDW
WSSPGFAIEKIRVKAGETQKKVIFCSREKVSHLQKGKSPAVFVKCHDKSLNKKSG
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctgctggccctggccgtgtgcctccagagtctgaccgct
tcccgcggaggggtggccgccgccgaccacagaagagattttatagacattgaaagtaaa
tttgccctaaggacccccgaagacacagctgaggacacttgccacctcattcctggagta
gcagagtctgtggctacctgccacttcaatcacagcagcaaaaccttcatggtgatccac
ggctggacggtaacaggaatgtatgagagttgggtgccaaaacttgtggccgccctatac
aagagagaaccagactccaacgtcattgtggtggactggctgtcacgggctcagcaacat
tacccagtgtccgcaggctacaccaaactggtgggacaagatgtggccaggtttatcaac
tggatggaggaggaatttaactaccctctggacaatgtccatctcttgggatacagcctt
ggagctcatgctgctggcattgcaggaagtctgaccaataagaaagtcaacagaattact
ggcctcgatccagctggacctaactttgagtatgcagaagccccgagtcgcctttctcct
gatgatgcggattttgtagacgtcttacatacattcactagagggtcccctggccgaagc
attggaatccagaaaccagttgggcacgttgacatttacccaaatggaggtacttttcag
ccaggatgtaacattggagaagctattcgtgtgattgcagagagaggccttggagatgtg
gaccagctagtgaagtgctcccatgagcgttccattcatctcttcattgactccctgctg
aatgaagaaaatccaagtaaggcctaccggtgcagttccaaggaagcctttgagaaaggg
ctctgcctgagttgtagaaagaaccgctgcaacaatctgggctatgagatcaacaaagtc
agagccaaaagaagcagcaaaatgtacctgaagactcgttctcagatgccctacaaagtc
ttccattaccaagtaaagattcatttttctgggactaagagtgaaacccagaccaaccag
gccttcgagatttctctgtatggcaccgtggctgagagtgagaacatcccattcacccta
cctgaagtttccacaaataagacatactccttcctgatttacacagaggtagatattgga
gaactactcatgttgaagctcaaatggaacagtgattcatacttcagctggtcagactgg
tggagcagtcctggctttgccattgagaagatcagagtcaaagcaggagaaactcagaaa
aaggtgatcttctgttctagggagaaagtttctcatttgcagaaaggaaagtcacctgcg
gtatttgtgaaatgccatgacaagtctctgaataagaagtcaggctga

DBGET integrated database retrieval system