KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050065
Entry
101050065         CDS       T04350                                 

Gene name
TCEB1
Definition
(RefSeq) transcription elongation factor B polypeptide 1 isoform X1
  KO
K03872  elongin-C
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq04120  Ubiquitin mediated proteolysis
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101050065 (TCEB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101050065 (TCEB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101050065 (TCEB1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101050065 (TCEB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101050065 (TCEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101050065 (TCEB1)
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101050065 (TCEB1)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     101050065 (TCEB1)
   ECS complex
     101050065 (TCEB1)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101050065 (TCEB1)
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 101050065
NCBI-ProteinID: XP_010349730
UniProt: A0A2K6T9F2
LinkDB
Position
Unknown
AA seq 112 aa
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt   +upstreamnt  +downstreamnt
atggatggagaggagaaaacctatggtggctgtgaaggccctgatgccatgtatgtcaaa
ttgatatcatctgatggccatgaatttattgtaaaaagagaacatgcattaacatcaggc
acaataaaagccatgttgagtggcccaggtcaatttgctgagaacgaaaccaatgaggtc
aattttagagagataccttcacatgtgctatcaaaagtatgcatgtattttacgtacaag
gttcgctacactaacagctccactgagattcctgaattcccaattgcacctgaaattgca
ctagaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system