KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050177
Entry
101050177         CDS       T04350                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04071  Sphingolipid signaling pathway
sbq04115  p53 signaling pathway
sbq04141  Protein processing in endoplasmic reticulum
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04215  Apoptosis - multiple species
sbq04217  Necroptosis
sbq04722  Neurotrophin signaling pathway
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101050177 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    101050177 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101050177 (BAX)
   04215 Apoptosis - multiple species
    101050177 (BAX)
   04217 Necroptosis
    101050177 (BAX)
   04115 p53 signaling pathway
    101050177 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101050177 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    101050177 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101050177 (BAX)
   05202 Transcriptional misregulation in cancer
    101050177 (BAX)
   05203 Viral carcinogenesis
    101050177 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101050177 (BAX)
   05212 Pancreatic cancer
    101050177 (BAX)
   05225 Hepatocellular carcinoma
    101050177 (BAX)
   05226 Gastric cancer
    101050177 (BAX)
   05214 Glioma
    101050177 (BAX)
   05216 Thyroid cancer
    101050177 (BAX)
   05220 Chronic myeloid leukemia
    101050177 (BAX)
   05217 Basal cell carcinoma
    101050177 (BAX)
   05218 Melanoma
    101050177 (BAX)
   05213 Endometrial cancer
    101050177 (BAX)
   05224 Breast cancer
    101050177 (BAX)
   05222 Small cell lung cancer
    101050177 (BAX)
   05223 Non-small cell lung cancer
    101050177 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101050177 (BAX)
   05014 Amyotrophic lateral sclerosis
    101050177 (BAX)
   05016 Huntington disease
    101050177 (BAX)
   05020 Prion disease
    101050177 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    101050177 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101050177 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101050177 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101050177 (BAX)
   05152 Tuberculosis
    101050177 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101050177 (BAX)
   05170 Human immunodeficiency virus 1 infection
    101050177 (BAX)
   05161 Hepatitis B
    101050177 (BAX)
   05160 Hepatitis C
    101050177 (BAX)
   05164 Influenza A
    101050177 (BAX)
   05162 Measles
    101050177 (BAX)
   05168 Herpes simplex virus 1 infection
    101050177 (BAX)
   05163 Human cytomegalovirus infection
    101050177 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101050177 (BAX)
   05169 Epstein-Barr virus infection
    101050177 (BAX)
   05165 Human papillomavirus infection
    101050177 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101050177 (BAX)
   01524 Platinum drug resistance
    101050177 (BAX)
   01522 Endocrine resistance
    101050177 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101050177 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101050177 (BAX)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101050177 (BAX)
Transporters [BR:sbq02000]
 Other transporters
  Pores ion channels [TC:1]
   101050177 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 101050177
NCBI-ProteinID: XP_003940380
LinkDB
Position
Unknown
AA seq 173 aa
MKTGALLLQGFIQDRAGRIGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRM
IATVDTNSPREVFFRVAADMFSDGNFNWGRVVAFFYFASKLVLKALCAKVPELIRTIMGW
TLDFLRERLLGWIQDQGGWDSLLSYFGTPTWQTVTIFVAGVLTASLTIWKNMG
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatcgga
ggggaggcacccgagctggccctggacccggtgccccaggatgcgtccaccaagaagctg
agcgagtgtctcaagcgcatcggagacgaactggacagtaacatggagctgcagaggatg
atcgccactgtggacacaaactccccccgagaggtctttttccgagtggcggctgacatg
ttctctgatggcaacttcaactggggccgggttgtcgcctttttctactttgccagcaaa
ctggtgctcaaggccctgtgtgccaaggtgcccgagctgatcagaaccatcatgggctgg
actttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggat
agcctcctctcctactttgggacacccacgtggcagacagtgaccatctttgtggctgga
gtgctcaccgcctcacttaccatctggaagaacatgggctga

DBGET integrated database retrieval system