KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050343
Entry
101050343         CDS       T04350                                 

Gene name
FLCN
Definition
(RefSeq) folliculin isoform X1
  KO
K09594  folliculin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04150  mTOR signaling pathway
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    101050343 (FLCN)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101050343 (FLCN)
SSDB
Motif
Pfam: Folliculin_C Folliculin
Other DBs
NCBI-GeneID: 101050343
NCBI-ProteinID: XP_003929462
UniProt: A0A2K6TVZ3
LinkDB
Position
Unknown
AA seq 617 aa
MLPPCLPHLAVASCVLRWCRWWKCDSAEWQASWSLQVIMNAIVALCHFCELHGPRTLFCT
EVLHAPLPQGAGNEDSPGQGEQAEEEEGGIQMSSRMRAHSPAEGASVDSSSPGPKKSDMC
EGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSIVRQACVRSLSCEVCPGREGPIF
FGDEQHGFVFSHTFFIKDSLARGFQRWYSVITIMMDRIYLINSWPFLLGKVRGIIDELQG
KALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSFAWLL
KACGSRLTEKLLEGAPTEDTLVQMEKLADLEEESETWDNSEAEEEEKAPVLPEGAEGREL
TQGLAESSSLAGCGSWQPRKLPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVD
LVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVH
AAARSSLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQ
CLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYK
SHLMSTVRSPTASESRS
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgctgccaccgtgcctgccccatttggcagtggcctcctgtgtgctgcgctggtgtaga
tggtggaagtgtgactctgctgagtggcaggcctcttggagtctccaagtcatcatgaat
gccatcgtggctctctgccacttctgcgagctccacggcccccgcactctcttctgcacg
gaggtcctgcacgcccctcttccccaaggggctgggaatgaggacagccccggccagggc
gagcaggcggaggaagaggaaggtggcattcagatgagcagccggatgcgcgcccacagc
cctgctgagggggccagtgtcgattccagcagcccggggcccaaaaagtcagacatgtgt
gagggctgccggtcacttgctgcagggcacccggggtatatcagccacgataaagagacc
tccatcaaatacgtcagccaccagcaccccagccacccccagctcttcagcattgtccgc
caggcctgtgtccggagcctgagctgtgaggtctgccctggccgcgaaggccccatcttc
ttcggagatgagcagcatggctttgtgttcagccatactttcttcatcaaggacagcctg
gccaggggcttccagcgctggtacagcgtcatcaccatcatgatggaccggatctacctc
atcaactcctggcccttcctgctggggaaggtccggggaatcatcgacgagctccagggc
aaggcgctcaaggtgtttgaggcagagcagtttggatgcccacagcgtgcgcagaggatg
aacacagccttcacaccattcctgcaccagaggaacggcaatgccgcccgctcgctgacg
tcgctgacaagtgatgacaacttgtgggcgtgcctgcacacctcctttgcctggctcctg
aaggcatgtggcagccggctgaccgagaagctcctggaaggtgcccccactgaggacacg
ttggtccagatggagaagctcgcagatttagaagaggaatcagaaacctgggacaactct
gaggctgaagaggaggagaaagcccctgtgttgccggagggtgcagaagggcgggagctg
acccagggcctggcagagtcctcctctcttgcaggctgtgggagctggcagccccggaag
ctgccagtcttcaagtccctccggcacatgaggcaggtcctgggagccccgtctttccgc
atgctggcctggcacgttctcatggggaaccaggtgatctggaaaagcagagacgtggac
ctcgtgcagtcagcctttgaagtgcttcggaccatgctgcccgtgggctgcgtccgcatc
atcccgtacagcagccagtacgaggaggcctatcggtgcaacttcctggggctcagcccg
cacgtgcagatccccccccacgtgctctcctcagagtttgctgtcatcgtggaggtccat
gcggctgcacgctccagcctccaccctgtagggtgtgaggacgaccagtctctcagcaag
tacgagtttgtggtgaccagtgggagccctgtagctgcagaccgagtcggccccaccatc
ctgaataagattgaggccgccctgaccaaccagaacctgtctgtggatgtggtggaccag
tgcctcgtctgcctcaaggaggagtggatgaacaaagtgaaggtgctttttaagttcacc
aaggtggacagtcggcctaaagaggacacgcagaagctgctgagcatcctgggcgcctcc
gaggaggacaacgtcaagcttctgaagttctggatgactggcctgagcaagacctacaag
tcacacctcatgtccacggtccgcagtcccacggcctcggagtctcggagctga

DBGET integrated database retrieval system