KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050505
Entry
101050505         CDS       T04350                                 

Gene name
PSMC1
Definition
(RefSeq) 26S protease regulatory subunit 4
  KO
K03062  26S proteasome regulatory subunit T2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03050  Proteasome
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05165  Human papillomavirus infection
sbq05169  Epstein-Barr virus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101050505 (PSMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101050505 (PSMC1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101050505 (PSMC1)
   05012 Parkinson disease
    101050505 (PSMC1)
   05014 Amyotrophic lateral sclerosis
    101050505 (PSMC1)
   05016 Huntington disease
    101050505 (PSMC1)
   05017 Spinocerebellar ataxia
    101050505 (PSMC1)
   05020 Prion disease
    101050505 (PSMC1)
   05022 Pathways of neurodegeneration - multiple diseases
    101050505 (PSMC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101050505 (PSMC1)
   05165 Human papillomavirus infection
    101050505 (PSMC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sbq03051]
    101050505 (PSMC1)
Proteasome [BR:sbq03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     101050505 (PSMC1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 RuvB_N AAA_5 AAA_16 AAA_18 IstB_IS21 AAA_25 ATPase AAA_33 AAA_28 AAA_3 RNA_helicase AAA_14 TIP49 Mg_chelatase PhoH AAA_7 Prot_ATP_OB_N NACHT AAA_24 BLOC1_2 NB-ARC AAA_30 ABC_tran Parvo_NS1 DUF3215 TsaE Sigma54_activat
Other DBs
NCBI-GeneID: 101050505
NCBI-ProteinID: XP_010348883
UniProt: A0A2K6T1L7
LinkDB
Position
Unknown
AA seq 440 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGIPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggtcatggtcctggaggtggcaagaaggatgacaaggac
aagaaaaagaaatatgaacctcctgtaccaactagagtggggaaaaagaagaagaaaaca
aagggaccagatgctgccagcaaattgccactggtgacacctcacactcagtgccggtta
aaattactgaaattagagagaattaaagactaccttctcatggaggaagaattcattaga
aatcaggaacaaatgaaaccattagaagaaaagcaagaggaggaaagatcaaaagtggat
gatctgaggggcatcccaatgtcagtaggaaccttggaagagatcattgatgacaatcat
gccatcgtgtctacatctgtgggctcagaacactacgtcagcattctgtcatttgtagac
aaggatctgctggaacctggctgctcagtcctgctcaaccacaaggtgcatgccgtgata
ggggtgctgatggatgacacagatcccctggtcacagtgatgaaggtggaaaaggccccc
caggagacctatgctgatattgggggcttggataaccaaattcaggaaattaaggaatct
gtggagcttcctctcacccaccccgagtattatgaagagatgggtataaagcctcctaag
ggggtcattctctatggtccacctggcacaggtaaaaccttattagccaaagcagtagca
aaccaaacctcagccactttcttgagagtggttggctctgaacttattcagaagtaccta
ggtgatgggcccaaactcgtacgggaactgtttcgagttgctgaagaacacgcgccgtcc
atcgtgttcattgatgaaattgacgccattgggacaaaaagatatgactcaaattctggt
ggtgagagagaaattcagcgaacaatgttggaactgttgaaccaactggatggatttgat
tctaggggagatgtgaaagttatcatggccacaaaccgaatagaaactctggatccagca
cttatcagaccaggccgcattgacaggaagatcgagttccccctgcctgatgaaaagact
aagaagcgcatctttcagattcacacaagcaggatgacgctggctgatgatgtaaccctg
gacgacttgatcatggctaaagatgacctctctggtgctgacatcaaggcaatctgtaca
gaagctggtctgatggccttaagagaacgtagaatgaaagtaacaaatgaagacttcaaa
aaatctaaagaaaatgttctttataagaaacaggaaggcacccctgaagggctctatctc
tag

DBGET integrated database retrieval system