KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050509Help
Entry
101050509         CDS       T04350                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00500  Starch and sucrose metabolism
sbq01100  Metabolic pathways
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04910  Insulin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04931  Insulin resistance
Module
sbq_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101050509 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101050509 (GYS1)
   04152 AMPK signaling pathway
    101050509 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101050509 (GYS1)
   04922 Glucagon signaling pathway
    101050509 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    101050509 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sbq01003]
    101050509 (GYS1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101050509 (GYS1)
Glycosyltransferases [BR:sbq01003]
 Polysaccharide
  Storage polysaccharide
   101050509 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 101050509
NCBI-ProteinID: XP_003940381
UniProt: A0A2K6SUB5
LinkDB All DBs
Position
Unknown
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPNEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTVTSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgatctggagaacacagtgctcttcgaagtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacaggggatgaatggggcgac
aactactacctggtggggccgtacacggagcagggcgtgaggacccaggtggagctgctg
gaggcccccaccccggccctgaagaggacactggactccatgaacagcaaaggctgcaag
gtgtattttgggcgctggctgatcgagggaggccccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggagagctctgggatacctgcaacatcggg
gtgccgtggtacgaccgcgaggccaacgacgctgtcctctttggctttctcaccacctgg
ttcctgggtgagttcctggcgcagagtgaggagaagccgcacgtggttgcacacttccat
gagtggttggcaggcattggactctgcctgtgtcgtgcccggcgactgcctgtggcgacc
atcttcaccacccacgccacgctgctggggcgctacctgtgtgctggtgccgtggacttc
tacaacaacctggagaacttcaacgtggacaaggaagcaggtgagaggcagatctatcac
cgctactgcatggaaagggcggcagcccactgtgctcacgtcttcactaccgtgtcccag
atcactgccattgaggcacagcacttgctcaagaggaaaccagatattgtgacccccaat
ggcctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaagggtgctgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaacggcagcgagcag
acagtggttgctttcttcatcatgccggcgcggaccaacaatttcaacgtggagaccctc
aaaggccaggccgtgcgcaaacagctttgggacacggccaacacggtgaaggaaaagttc
gggaggaagctttacgaatccttgctggttgggagccttccggacatgaacaagatgctg
gataaggaagatttcaccatgatgaagagagccatctttgccacgcagcggcagtccttc
ccccctgtgtgcacccacaatatgctggacgactcctcagaccccatcctgaccaccatc
cgccgaattggcctcttcaacagcagtgccgacagagtgaaggtgattttccacccggag
ttcctctcctccacaagccccctgctccctgtggactatgaggagtttgtccgtggctgt
caccttggggtcttcccctcctactatgaaccatggggctacacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaatctctccggctttggctgcttcatggaggaa
cacatcgcagatccctcagcctacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacagagcgcctctccgaccttctagactggaaatac
ctaggccggtactacatgtccgcacgacacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccaacgaggcggatgcgacccaggggtaccgctacccacggccagcc
tcggtgccaccgtcgccctcgctgtcacggcactccagcccgcaccaaagcgaggacgag
gaggatccccggaacgggccgctggaggaagacggcgagcgctatgatgaggacgaggag
gccgccaaggaccggcgcaacatccgtgccccggagtggccgcgccgcgcctcctgcacc
tcctccaccagcgggagcaagcgtaactctgtggacacggtcacctccagctcgctcagc
acccccagcgagcccctcagccccaccagctccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system