KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050538
Entry
101050538         CDS       T04350                                 

Gene name
UBE3A
Definition
(RefSeq) ubiquitin-protein ligase E3A isoform X1
  KO
K10587  ubiquitin-protein ligase E3 A [EC:2.3.2.26]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04120  Ubiquitin mediated proteolysis
sbq05165  Human papillomavirus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101050538 (UBE3A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101050538 (UBE3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101050538 (UBE3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101050538 (UBE3A)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     101050538 (UBE3A)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  HECT type E3
   101050538 (UBE3A)
SSDB
Motif
Pfam: HECT AZUL PCM1_C
Other DBs
NCBI-GeneID: 101050538
NCBI-ProteinID: XP_010329837
UniProt: A0A2K6T289
LinkDB
Position
Unknown
AA seq 873 aa
MATACKRSPGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLR
MDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDF
KDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQ
AKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRV
YTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPEYL
EMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRNLV
NDDDAIVAASKCLKMVYYANVVGGDVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKG
PRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTCPF
ILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEM
IAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFN
PSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSL
KDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYIL
NKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTR
DSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHT
CFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
NT seq 2622 nt   +upstreamnt  +downstreamnt
atggccacagcttgtaaaagatcaccaggagaacctcagtctgacgacattgaagctagc
cgaatgaagcgagcagctgcaaagcatctaatagaacgctactaccaccagttaaccgag
ggctgtggaaatgaggcctgcacgaatgagttttgtgcttcctgtccgacttttcttcgt
atggataataatgcagcagctattaaagccctcgagctttataagattaatgcaaaactc
tgtgatcctcatccctccaagaaaggagcaagctcagcttacctcgagaactcgaaaggt
gcccctaacaactcctgctctgagataaaaatgaacaagaaaggcgctagaattgatttt
aaagatgtgacttacttgacagaagagaaggtatatgaaattcttgaattatgtagagaa
agagaggattattcccctttaatccgtgtgattggaagagttttttctagtgctgaggca
ttggtacagagcttccggaaagttaaacaacacaccaaggaagaactgaaatctcttcaa
gccaaggatgaagataaggatgaagatgaaaaggaaaaagccgcatgctctgctgctgct
atggaagaagactcagaagcatcttcctccaggataggtgacagctcacagggagacaac
aatttgcaaaaattaggccctgatgatgtatctgtggatattgatgccattagaagggtc
tacaccagattgctctctaatgaaaaaattgaaactgcctttctcaatgcacttgtgtat
ttgtcacctaatgtggaatgtgacttgacgtatcacaacgtatactctcgagatcctaat
tatctgaatttgttcattatcgtaatggagaatagaaatctccacagtcctgaatatctg
gaaatggcattgccattattttgcaaagcaatgagcaagctaccccttgcagcccaagga
aaactgatcagactgtggtcgaaatacaatgcagaccagattcggagaatgatggagaca
tttcagcaacttattacttataaagtcataagcaatgaatttaacagtcgaaatctagtg
aatgatgatgatgccattgttgctgcttcgaagtgcttgaagatggtttactatgcaaat
gtagtaggaggggacgtggacacaaatcacaatgaagaagatgatgaagagcccatccct
gagtccagtgagctgacacttcaggagcttctgggagaagaaagaagaaacaagaaaggt
cctcgagtggaccccctggaaactgaacttggtgttaaaaccctagattgtcgaaaacca
ctcatcccttttgaagagtttattaatgaaccactgaatgaggttctagaaatggataaa
gattatacttttttcaaagtagaaacagagaacaaattctcttttatgacatgtcccttt
atattgaatgctgtcacaaagaatttgggattatattatgacaatagaattcgcatgtac
agtgaacgaagaatcactgttctctacagcttagttcaaggacagcagttgaatccgtat
ttgagactcaaagttagacgtgaccatatcatagatgatgcactcgtccggctagagatg
atcgctatggaaaatcctgcagacttgaagaagcagttgtatgtggaatttgaaggagaa
caaggagttgatgagggaggtgtttccaaagaattttttcagctggttgtggaggaaatc
ttcaatccagatattggtatgttcacatacgacgaatctacaaaattgttttggtttaat
ccgtcttcttttgaaaccgagggtcagtttactctgattggcatagtgctgggtctggct
atttacaacaactgtatactggatgtacattttcccatggttgtctacaggaagctaatg
gggaaaaaagggacttttcgtgacttgggagactctcatccagttctatatcagagttta
aaagatttattggagtatgaagggaatgtggaagatgacatgatgatcactttccagata
tcacaaacagatctttttggtaacccaatgatgtatgatctgaaggaaaacggtgataaa
attccaattacaaatgaaaacaggaaggaatttgtcaatctttattctgactacattctc
aataaatcagtagaaaaacagttcaaggcttttcggagaggttttcatatggtgaccaat
gaatctcccttaaagtacttattcagaccagaagaaattgaattgcttatatgtggaagc
cggaatctagatttccaggcactagaagaaactacagaatatgacggtggctacaccagg
gattctgttctaattagggagttctgggaaatcgttcattcattcacagatgaacagaaa
agactcttcttgcagtttaccacgggcacagacagagcacctgtgggaggactaggaaaa
ttaaagatgatcatagccaaaaatggcccagacacagaaaggttacctacatctcatact
tgctttaatgtgcttttacttccggaatattcaagcaaagaaaaacttaaagagagattg
ttgaaggccatcacatatgccaaaggatttggcatgctgtaa

DBGET integrated database retrieval system