KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050794
Entry
101050794         CDS       T04350                                 

Gene name
TRADD
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X1
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04210  Apoptosis
sbq04217  Necroptosis
sbq04622  RIG-I-like receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04668  TNF signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq05132  Salmonella infection
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101050794 (TRADD)
   04064 NF-kappa B signaling pathway
    101050794 (TRADD)
   04668 TNF signaling pathway
    101050794 (TRADD)
   04071 Sphingolipid signaling pathway
    101050794 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101050794 (TRADD)
   04217 Necroptosis
    101050794 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101050794 (TRADD)
   04657 IL-17 signaling pathway
    101050794 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101050794 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101050794 (TRADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101050794 (TRADD)
   05152 Tuberculosis
    101050794 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101050794 (TRADD)
   05160 Hepatitis C
    101050794 (TRADD)
   05164 Influenza A
    101050794 (TRADD)
   05162 Measles
    101050794 (TRADD)
   05168 Herpes simplex virus 1 infection
    101050794 (TRADD)
   05163 Human cytomegalovirus infection
    101050794 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101050794 (TRADD)
   05169 Epstein-Barr virus infection
    101050794 (TRADD)
   05165 Human papillomavirus infection
    101050794 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2
Other DBs
NCBI-GeneID: 101050794
NCBI-ProteinID: XP_003936333
LinkDB
Position
Unknown
AA seq 312 aa
MAAGQNGHGECVGSAYLFVESSLDKVVLSDAYVHPQQKMAVYRALQTALTESGGSPDLLQ
MLKIHRSDPQLVVQLRFCGRQPCSCFLRAYREGALRAALQRSLAAALFQHSLSLQLELRA
GAERLDALLADEERCLNCILAQQPDRLRDEELAELEDALRNLKCGSGAQRGDGEVSLAPS
QLPVPSLSEVKPRPPPMPAQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPSGSLA
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacggagagtgtgtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgtgcacccccagcagaagatggca
gtgtacagggctttgcagactgccttgacagagagcggcgggagcccggacttgctgcag
atgctgaagatccaccgcagcgacccgcagctcgttgtgcagttgcgattctgcgggcgc
cagccctgcagctgcttcctccgcgcctaccgcgagggggcgctacgcgccgcgctgcag
aggagcctggcggccgcgctcttccaacactcgctatcgctgcaactggagctgcgcgct
ggcgccgagcggctggacgctttgctggcggacgaggagcgctgtttgaattgcatccta
gcccagcagcccgaccggctccgggacgaagaactggctgagctggaggatgcgctgagg
aacctgaagtgcggctcgggggcccagcgtggcgacggggaggtctctttggccccctcg
cagctccccgtgccctctctgtcagaggtgaagccgcggccgccgccaatgcctgcccag
acttttctgttccagggtcagcctgtagtgaaccggccgctgagcctgcaggaccaacag
acgttcgcgcgctccgtgggcctcaaatggcgcaaggtggggcgctcactgcagcggggc
tgcagagcgctgcgggacccggcgctagactcgctggcctacgagtacgagcgcgagggg
ttgtatgagcaggccttccagctgctgcgccgcttcgtgcaggccgagggtcgccgcgcc
acgctgcagcgcctggtggaggcacttgaggagaacgagctcaccagcctggcagaggac
ttgctgggcctgactgatcccagtggcagcctggcctag

DBGET integrated database retrieval system