KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050895
Entry
101050895         CDS       T04350                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04062  Chemokine signaling pathway
sbq04144  Endocytosis
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04530  Tight junction
sbq04660  T cell receptor signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04912  GnRH signaling pathway
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101050895 (CDC42)
   04014 Ras signaling pathway
    101050895 (CDC42)
   04015 Rap1 signaling pathway
    101050895 (CDC42)
   04370 VEGF signaling pathway
    101050895 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101050895 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101050895 (CDC42)
   04520 Adherens junction
    101050895 (CDC42)
   04530 Tight junction
    101050895 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101050895 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101050895 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    101050895 (CDC42)
   04670 Leukocyte transendothelial migration
    101050895 (CDC42)
   04062 Chemokine signaling pathway
    101050895 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101050895 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101050895 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    101050895 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101050895 (CDC42)
   05205 Proteoglycans in cancer
    101050895 (CDC42)
   05203 Viral carcinogenesis
    101050895 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101050895 (CDC42)
   05211 Renal cell carcinoma
    101050895 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101050895 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101050895 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101050895 (CDC42)
   05135 Yersinia infection
    101050895 (CDC42)
   05100 Bacterial invasion of epithelial cells
    101050895 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101050895 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101050895 (CDC42)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101050895 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101050895 (CDC42)
   04031 GTP-binding proteins [BR:sbq04031]
    101050895 (CDC42)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101050895 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    101050895 (CDC42)
  Macropinocytosis
   Ras GTPases
    101050895 (CDC42)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101050895 (CDC42)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101050895 (CDC42)
  Exosomal proteins of breast milk
   101050895 (CDC42)
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101050895 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 101050895
NCBI-ProteinID: XP_010343777
UniProt: A0A2K6TEV2
LinkDB
Position
Unknown
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggtgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaataaatttccatcagaatatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagaaccatacactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtttctccatcttcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcatcactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgatctgaaggctgtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system