KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051066
Entry
101051066         CDS       T04350                                 

Gene name
RBPJ
Definition
(RefSeq) recombining binding protein suppressor of hairless isoform X3
  KO
K06053  recombining binding protein suppressor of hairless
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04330  Notch signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq05017  Spinocerebellar ataxia
sbq05165  Human papillomavirus infection
sbq05169  Epstein-Barr virus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101051066 (RBPJ)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101051066 (RBPJ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101051066 (RBPJ)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101051066 (RBPJ)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101051066 (RBPJ)
   05165 Human papillomavirus infection
    101051066 (RBPJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101051066 (RBPJ)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Other transcription factors
   Others
    101051066 (RBPJ)
SSDB
Motif
Pfam: BTD LAG1-DNAbind TIG RHD_dimer
Other DBs
NCBI-GeneID: 101051066
NCBI-ProteinID: XP_003927542
UniProt: A0A2K6T7Y6
LinkDB
Position
Unknown
AA seq 486 aa
MAWIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVY
LMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSD
KRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLR
SQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSV
TGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCP
KEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELT
GQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGI
IYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSS
TATVVS
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggcgtggattaaaaggaaatttggtgagcggcctccacctaaacgacttactagggaa
gctatgcgaaattatttaaaagagcgaggggatcaaacagtacttattcttcatgcaaaa
gttgcacagaagtcatatggaaatgaaaaaaggtttttttgccctcctccttgtgtatat
cttatgggcagtggatggaagaaaaaaaaagaacaaatggaacgtgatggttgttctgaa
caagagtctcaaccgtgtgcatttattgggataggaaatagtgaccaagaaatgcagcag
ctaaacttggaaggaaagaactattgcacagccaaaacattgtacatatctgattcagac
aagcgaaagcacttcatgttgtctgtaaagatgttctatggcaacagtgatgacattggt
gtgttcctcagcaagcggataaaagtcatctccaaaccttccaaaaagaagcagtcgttg
aaaaatgctgacttatgcattgcctcaggaacaaaggtggctctgtttaatcgactacga
tcccagacagttagtaccagatacttgcatgtagaaggaggtaattttcatgccagttca
cagcagtggggagcattttacattcatctcttggatgatgatgaatcagaaggagaagaa
ttcacagtccgagatggctatatccactatggacaaacagtcaaacttgtgtgctcagtt
actggcatggcactcccaagattgatcattaggaaagttgataagcagaccgcattattg
gatgcagatgatcctgtgtcacaactccataaatgtgcattttaccttaaggatacagaa
agaatgtacttgtgcctttctcaagaaagaataattcaatttcaggccactccatgccca
aaagaaccaaataaagagatgataaatgatggcgcttcctggacaatcattagcacagat
aaggcagagtatacattttacgagggaatgggccctgtccttgccccagtcacgcctgtg
cctgttgtagagagccttcagttgaatggcggtggggacgtagcaatgcttgaacttaca
ggacagaatttcactccaaatttacgagtgtggtttggggatgtagaagctgaaactatg
tacaggtgtggggaaagtatgctctgcgtcgtcccagacatttctgcattccgagaaggt
tggagatgggtcaggcaaccagtccaggttccagtaactttggtccgaaatgatggaatc
atttattccaccagccttacctttacctacacaccagaaccagggcctcggccgcactgc
agcgcagcaggagcgatccttcgagccaattcaagccaggtgccccctaacgaatcaaac
acaaacagcgagggaagttacacaaacgccagcacaaattcaaccagtgtcacatcatcc
acagcaacagtggtatcctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051431
Entry
101051431         CDS       T04350                                 

Gene name
RBPJL
Definition
(RefSeq) recombining binding protein suppressor of hairless-like protein isoform X1
  KO
K06053  recombining binding protein suppressor of hairless
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04330  Notch signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq05017  Spinocerebellar ataxia
sbq05165  Human papillomavirus infection
sbq05169  Epstein-Barr virus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101051431 (RBPJL)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101051431 (RBPJL)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101051431 (RBPJL)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101051431 (RBPJL)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101051431 (RBPJL)
   05165 Human papillomavirus infection
    101051431 (RBPJL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101051431 (RBPJL)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Other transcription factors
   Others
    101051431 (RBPJL)
SSDB
Motif
Pfam: BTD LAG1-DNAbind
Other DBs
NCBI-GeneID: 101051431
NCBI-ProteinID: XP_003936564
UniProt: A0A2K6TM52
LinkDB
Position
Unknown
AA seq 528 aa
MPLLKYRRLIWLDTYSPADPEVPPNPLTHLSLRDRSEMQLQSEADRRSLPGTWTRSSPEH
ATILRGGVRRCLQQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKSGQGQ
AHQAGESGPTVCGYMGLDSASGSAAETQKLNFEQQPDSREFGCAKTLYVSDADKRKHFRL
VLRLVLRGGLELGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTR
YLSVQDGAFVASARQWAAFTLHLADGHSSQGDFPRREGYVRYGSLVQLVCTVTGITLPPM
IIRKVAKQCALLDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEAN
RALLNDSSCWTIIGTEAVEFSFSTSLACTREPVTPVPLISTLELSGGGDVAMLELHGENF
HAGLKVWFGDVEAETMYRSPRSLVCVVPDVAAFGSDWRWLRAPITVPVSLVRVDGIFYPS
AFSFTYTPEYSARPGPPGTPEPATGADALLESIHQEFTRTNFHLFIQT
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgcctctgctaaaataccgtcgcctgatctggcttgacacctactcccctgcagacccc
gaagtgcctcccaaccctttgactcacctgagcctccgggacagatcagagatgcagctg
cagagcgaagccgacaggcggagcctcccggggacttggaccaggtcatccccagagcac
gccaccattcttcggggaggcgtgcgcaggtgcctgcagcaacagtgcgaacagactgtg
cggatcctgcacgccaaggtggcccagaaatcctacggaaacgagaagcggttcttctgc
cccccgccctgtgtctacctctcggggcctggctggagggtgaagtcggggcagggccaa
gctcaccaggcgggggagtcggggccgacggtctgtggttacatgggactggacagcgcg
tccggcagcgccgcggagacgcagaagctgaatttcgagcagcagccggactccagagaa
ttcggctgcgccaagaccctgtacgtctcagatgcagacaagaggaagcactttcggctg
gtgctgcggctggtgctgcgcgggggcttggagctgggcaccttccacagccgcctcatc
aaggtcatctccaagccctcgcagaagaagcagtcgctgaaaaacaccgacctgtgcata
tcctccggctcaaaggtctccctcttcaaccgcctgcgatcccagacggtctctacacgc
tacctctctgtgcaggacggggcctttgtggccagtgcacgacagtgggctgccttcacg
ctccacctggctgatgggcactcttcccaaggagacttcccacggcgagagggctacgtt
cgctacggctccctggtgcagcttgtctgcacagtcaccgggatcacattaccccccatg
atcatccgtaaagtagccaagcagtgtgcactcctagatgtggatgagcccatctcccag
ctgcacaagtgtgcattccagtttccaggcagtcccccaggagggggaggtacctactta
tgccttgccacagagaaggtggtgcaatttcaggcctctccctgccccaaggaggcgaac
agggctctgcttaacgacagctcttgctggaccatcatcggcaccgaggcggtggaattc
tccttcagcaccagcctggcgtgtacgcgggagccggtcacgccggtgcccctcatcagc
accctcgagctgagcggcggaggcgatgtggccatgctggagctccacggagagaacttc
cacgcggggctcaaggtgtggtttggggacgtggaagcagaaaccatgtacaggagcccg
cggtccctggtgtgcgtggtgccggacgtggcggccttcggtagcgattggcgctggctg
cgcgctcccatcacagtgcccgtgagcctggtgcgcgtcgacgggatcttctaccctagt
gccttctccttcacctacaccccggaatacagcgcgcggccgggtccccccggcaccccc
gagcccgccaccggcgcggacgcgctcctggagagcatccatcaggagttcacgcgcacc
aacttccacctcttcattcaaacttag

DBGET integrated database retrieval system