KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051107
Entry
101051107         CDS       T04350                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X2
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04012  ErbB signaling pathway
sbq04062  Chemokine signaling pathway
sbq04110  Cell cycle
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04310  Wnt signaling pathway
sbq04340  Hedgehog signaling pathway
sbq04360  Axon guidance
sbq04390  Hippo signaling pathway
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04657  IL-17 signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04728  Dopaminergic synapse
sbq04910  Insulin signaling pathway
sbq04916  Melanogenesis
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05135  Yersinia infection
sbq05160  Hepatitis C
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05217  Basal cell carcinoma
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101051107 (GSK3B)
   04310 Wnt signaling pathway
    101051107 (GSK3B)
   04340 Hedgehog signaling pathway
    101051107 (GSK3B)
   04390 Hippo signaling pathway
    101051107 (GSK3B)
   04151 PI3K-Akt signaling pathway
    101051107 (GSK3B)
   04150 mTOR signaling pathway
    101051107 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101051107 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101051107 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    101051107 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101051107 (GSK3B)
   04657 IL-17 signaling pathway
    101051107 (GSK3B)
   04662 B cell receptor signaling pathway
    101051107 (GSK3B)
   04062 Chemokine signaling pathway
    101051107 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101051107 (GSK3B)
   04917 Prolactin signaling pathway
    101051107 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    101051107 (GSK3B)
   04919 Thyroid hormone signaling pathway
    101051107 (GSK3B)
   04916 Melanogenesis
    101051107 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101051107 (GSK3B)
   04722 Neurotrophin signaling pathway
    101051107 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    101051107 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101051107 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101051107 (GSK3B)
   05225 Hepatocellular carcinoma
    101051107 (GSK3B)
   05226 Gastric cancer
    101051107 (GSK3B)
   05217 Basal cell carcinoma
    101051107 (GSK3B)
   05215 Prostate cancer
    101051107 (GSK3B)
   05213 Endometrial cancer
    101051107 (GSK3B)
   05224 Breast cancer
    101051107 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101051107 (GSK3B)
   05020 Prion disease
    101051107 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    101051107 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101051107 (GSK3B)
   04931 Insulin resistance
    101051107 (GSK3B)
   04934 Cushing syndrome
    101051107 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101051107 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101051107 (GSK3B)
   05162 Measles
    101051107 (GSK3B)
   05163 Human cytomegalovirus infection
    101051107 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101051107 (GSK3B)
   05165 Human papillomavirus infection
    101051107 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101051107 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101051107 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101051107 (GSK3B)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     101051107 (GSK3B)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   101051107 (GSK3B)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101051107 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 101051107
NCBI-ProteinID: XP_003935456
UniProt: A0A2K6SYP5
LinkDB
Position
Unknown
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQTNNAASASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccgcaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcgggagaa
ctggttgccatcaagaaagtattgcaagacaagagatttaagaaccgagaactccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgtttcgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagccgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgcgtgttggctgagctgttactaggacaaccaatatttccgggggat
agtggtgtggatcagttggtggaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaatccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggactaaggtcttccgacctcgaactccaccggaggcgattgcactgtgtagccgtctg
ctggagtatacaccaactgcccgattgacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctggctaccatccttattcctcct
catgctcggattcaagcagctgcttcaacccccacaaatgccacagcagcctcagatgct
aatgctggagaccgtggacagaccaataatgctgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system