KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051224
Entry
101051224         CDS       T04350                                 

Gene name
FABP3
Definition
(RefSeq) fatty acid-binding protein, heart
  KO
K08752  fatty acid-binding protein 3, muscle and heart
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101051224 (FABP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101051224 (FABP3)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101051224 (FABP3)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 DP-EP
Other DBs
NCBI-GeneID: 101051224
NCBI-ProteinID: XP_003937640
UniProt: A0A2K6T9H4
LinkDB
Position
Unknown
AA seq 133 aa
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTIILKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
NT seq 402 nt   +upstreamnt  +downstreamnt
atggtggacgctttcctgggcacctggaagctagtggacagcaagaatttcgatgactac
atgaagtcactcggtgtgggttttgctaccaggcaggtggccagcatgaccaagcctacc
acaatcattgaaaagaatggtgacactatcatcctaaaaacacacagcaccttcaagaac
acagagatcagctttaagctgggggtggaatttgatgagacaacagcagatgacaggaag
gtcaagtccattgtgacactggatggaggcaaacttgttcacctacagaagtgggacggg
caagagacgacacttgtgcgggagctaattgatggaaaactcatcctgacactcacccac
ggcactgcagtttgcactcgcacttatgagaaagaggcatga

DBGET integrated database retrieval system