KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051228
Entry
101051228         CDS       T04350                                 

Gene name
APOA2
Definition
(RefSeq) apolipoprotein A-II
  KO
K08758  apolipoprotein A-II
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101051228 (APOA2)
  09154 Digestive system
   04979 Cholesterol metabolism
    101051228 (APOA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101051228 (APOA2)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101051228 (APOA2)
SSDB
Motif
Pfam: ApoA-II Apo-CIII
Other DBs
NCBI-GeneID: 101051228
NCBI-ProteinID: XP_003938035
UniProt: A0A2K6T326
LinkDB
Position
Unknown
AA seq 100 aa
MKLLTATVLLLTICSLEGALVRRQAEEPSMESLVSQYFQTVSDYGKDLMEKVKSSELQAQ
AKAYFEKSKEHLTPLVMKAGTDLVNFLNYFVELKAPPAAK
NT seq 303 nt   +upstreamnt  +downstreamnt
atgaagctgctcacagcaactgtgctgctcctcaccatctgcagccttgaaggagctttg
gttcgaagacaggcagaggagccgagtatggaaagcctggtgtctcagtacttccagacc
gtgtctgactatggcaaggacctgatggagaaggtcaagagctcagagcttcaggcccag
gccaaggcttattttgaaaagtcaaaggagcatctgacacccctggtcatgaaagctgga
acggatctggttaacttcttgaactatttcgtggaactcaaagcaccgcctgccgccaag
tga

DBGET integrated database retrieval system