KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051246
Entry
101051246         CDS       T04350                                 

Gene name
MMP1
Definition
(RefSeq) interstitial collagenase
  KO
K01388  matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04657  IL-17 signaling pathway
sbq04926  Relaxin signaling pathway
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05219  Bladder cancer
sbq05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101051246 (MMP1)
  09152 Endocrine system
   03320 PPAR signaling pathway
    101051246 (MMP1)
   04926 Relaxin signaling pathway
    101051246 (MMP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101051246 (MMP1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101051246 (MMP1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101051246 (MMP1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101051246 (MMP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbq01002]
    101051246 (MMP1)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     101051246 (MMP1)
Peptidases and inhibitors [BR:sbq01002]
 Metallo peptidases
  Family M10
   101051246 (MMP1)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Reprolysin_4 Peptidase_M54 DUF4953
Other DBs
NCBI-GeneID: 101051246
NCBI-ProteinID: XP_003923816
UniProt: A0A2K6UVQ8
LinkDB
Position
Unknown
AA seq 469 aa
MHSYPPLLLLLFWSVVSHGFPATLETQEQDVEIVQKYLEQYYDLKNDGKQVEKQRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLNVMKQARCGVPDVARFVLTEGNPRWEKTHLTYRIEN
YTPDLRRADVDHAIEKAFQLWSNVTPLTFTKVPKGQADIMISFVRGDHQDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDETWTNNFREYNLYRVAAHELGHSLGLSHSTDIGALMFPSY
TFSGDVQLAQDDIDGIQAIYGPSPNPVQPTGPQTPQVCDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLYGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVGNKYWRYDEYKRSMDAGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgcacagctatcctccgctgctgctgctgctgttctggagtgtggtgtctcatggcttc
ccagcaactctggaaacacaagagcaagatgtggagatagtgcagaaatacctggaacaa
tactacgacctgaagaacgatggcaagcaagttgaaaagcagagaaacagtggcccagtg
gttgaaaaattgaagcaaatgcaggaattctttgggctgaaagtgacggggaaaccagat
gctgaaaccctgaacgtgatgaagcaggccagatgtggagtgcctgatgtggctcggttt
gtcctcactgaggggaaccctcgctgggagaaaacacatctgacctacaggattgaaaat
tacactccagatttgcgaagagcagatgtggaccatgccattgagaaagcctttcaactc
tggagtaatgtcacacctctgacattcaccaaggtccctaagggtcaagcagacataatg
atatcttttgtcaggggagatcatcaggacaattctccctttgatggacctggaggaaat
cttgctcatgcttttcaaccaggcccaggtattggaggggatgctcattttgatgaagat
gaaacgtggaccaacaatttcagagagtacaacttataccgtgttgcggctcatgaactc
ggccattccctcggactctctcattctactgacattggagctttgatgttccccagctac
accttcagtggtgatgttcagctggctcaggatgacattgatggcatccaagccatatat
ggaccgtccccaaatcctgtccagcccacaggcccacaaaccccacaagtgtgtgacagc
aagctaacctttgatgctataactacgattcggggagaagtgatgttctttaaagacaga
ttctatatgcgcacaaatcccttctacccagaagttgagctcaatttcatttctgttttc
tggccacaactgccaaatgggcttgaagctgcttatgaatttgccgacagagatgaagtc
cggtttttcaaagggaataagtactgggctgttcagggacagaatgtgctgtacggatac
cccaaggacatctacagctcctttggcttccctagaactgtgaagcatattgatgctgct
ctttctgaggaaaatactggaaaaacctacttctttgttggtaacaaatactggaggtat
gatgaatataaacgatctatggatgcaggttatcccaaaatgatagcacatgattttcct
ggaattggccacaaggttgatgcggttttcatgaaagatggatttttttatttctttcat
ggaacaaggcaatacaaatttgatcctaaaacgaagagaattttaactctccagaaagct
aacagctggttcaactgcagaaaaaattga

DBGET integrated database retrieval system