KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051293Help
Entry
101051293         CDS       T04350                                 

Gene name
TUFM
Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
Translation factors [BR:sbq03012]
 Eukaryotic Type
  Elongation factors
   101051293 (TUFM)
 Prokaryotic Type
   101051293 (TUFM)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    101051293 (TUFM)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101051293 (TUFM)
  Exosomal proteins of breast cancer cells
   101051293 (TUFM)
  Exosomal proteins of colorectal cancer cells
   101051293 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 101051293
NCBI-ProteinID: XP_003930288
LinkDB All DBs
Position
Unknown
AA seq 447 aa AA seqDB search
MARATSRFSGLAASPTFLLQGLLRPVKASALSLLCRSLAVEAKKTYVRDKPHVNVGTIGH
VDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHT
DCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADA
VQDSEMVELVELEIRELLTEFGYKGQETPVIVGSALCALEGRDPELGLKSVQKLLDAVDT
YIPVPTRDLEKPFLMPIETVFSIPGRGTVVSGTLERGILKKGDDCELLGHSKNIRTVVTG
IEMFHKSLERAEAGDNLGALVRGLKREDVRRGLVMVKPGSVQACPKVEAQVYILSKEEGG
RHKPFVSHYMPIMFSMTWDMACRVILPPGKELAMPGEDLKLNLILRQPMILEKGQRFTLR
DGNRTIGTGLVTDTPAMTEEEKNLKWN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgcgacgagccgtttcagcggtctcgccgccagcccgactttcctgctgcag
ggtctgttgcggccggtgaaggcctcggcattgtccctcttgtgccgcagcttggccgtg
gaggccaagaagacttacgtgcgcgacaagccacatgtgaatgtgggtaccatcggccat
gtggaccacggcaagacgacgctgactgcagccatcacgaagattctagccgagggaggt
ggggctaagttcaagaagtacgaggagattgacaatgccccggaggagcgagctcggggt
atcaccatcaatgcggcccatgtggagtatagcactgccgcccgccactacgcccacaca
gactgcccgggtcatgcagattatgttaagaatatgatcacaggcaccgcaccccttgac
ggctgcatcctggtggtagcagccaatgatggccccatgccccagactcgagagcactta
ctgctggccagacagattggggtggagcatgtggtggtatatgtgaacaaggctgacgct
gtccaggactctgagatggtggagctggtggagctggagatccgggagctgctcactgag
tttggctataaaggacaggagaccccagtcatcgtaggctctgctctctgtgcccttgag
ggtcgggaccctgagttaggcctgaagtctgtgcagaagctgctggatgccgtggacact
tacatccccgtgcccacccgggacctggagaagcctttcctgatgcccatagagacggtg
ttctccatccctggccgtggcactgtggtgtcaggtacgctagagcgtggtattttaaag
aagggagatgactgtgagctcctgggacatagcaagaatattcgcactgtggtgacaggc
attgagatgttccacaagagcctggagagggctgaggccggagataacctcggggccctg
gtccgaggcttgaagagggaggatgtacgacggggcctggtcatggtcaagccgggttcc
gtccaagcgtgccccaaggtggaggcccaggtttacatcctcagtaaggaggaaggtggc
cgccacaagccctttgtgtcccactacatgcctatcatgttctccatgacttgggacatg
gcctgtcgggttatcctgcccccggggaaggagctcgccatgccaggggaggacctgaag
ctcaacctgatcttgcggcagccaatgatcttagagaaaggccagcgtttcacccttcga
gatggcaaccggaccatcggcaccggtctagttaccgacacgccggccatgactgaggag
gagaagaacctcaagtggaattaa

DBGET integrated database retrieval system