KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051293Help
Entry
101051293         CDS       T04350                                 

Gene name
TUFM
Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sbq03012]
    101051293 (TUFM)
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101051293 (TUFM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101051293 (TUFM)
Translation factors [BR:sbq03012]
 Eukaryotic Type
  Elongation factors
   101051293 (TUFM)
 Prokaryotic Type
   101051293 (TUFM)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    101051293 (TUFM)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101051293 (TUFM)
  Exosomal proteins of breast cancer cells
   101051293 (TUFM)
  Exosomal proteins of colorectal cancer cells
   101051293 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 101051293
NCBI-ProteinID: XP_003930288
LinkDB All DBs
Position
Unknown
AA seq 447 aa AA seqDB search
MARATSRFSGLAASPTFLLQGLLRPVKASALSLLCRSLAVEAKKTYVRDKPHVNVGTIGH
VDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHT
DCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADA
VQDSEMVELVELEIRELLTEFGYKGQETPVIVGSALCALEGRDPELGLKSVQKLLDAVDT
YIPVPTRDLEKPFLMPIETVFSIPGRGTVVSGTLERGILKKGDDCELLGHSKNIRTVVTG
IEMFHKSLERAEAGDNLGALVRGLKREDVRRGLVMVKPGSVQACPKVEAQVYILSKEEGG
RHKPFVSHYMPIMFSMTWDMACRVILPPGKELAMPGEDLKLNLILRQPMILEKGQRFTLR
DGNRTIGTGLVTDTPAMTEEEKNLKWN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgcgacgagccgtttcagcggtctcgccgccagcccgactttcctgctgcag
ggtctgttgcggccggtgaaggcctcggcattgtccctcttgtgccgcagcttggccgtg
gaggccaagaagacttacgtgcgcgacaagccacatgtgaatgtgggtaccatcggccat
gtggaccacggcaagacgacgctgactgcagccatcacgaagattctagccgagggaggt
ggggctaagttcaagaagtacgaggagattgacaatgccccggaggagcgagctcggggt
atcaccatcaatgcggcccatgtggagtatagcactgccgcccgccactacgcccacaca
gactgcccgggtcatgcagattatgttaagaatatgatcacaggcaccgcaccccttgac
ggctgcatcctggtggtagcagccaatgatggccccatgccccagactcgagagcactta
ctgctggccagacagattggggtggagcatgtggtggtatatgtgaacaaggctgacgct
gtccaggactctgagatggtggagctggtggagctggagatccgggagctgctcactgag
tttggctataaaggacaggagaccccagtcatcgtaggctctgctctctgtgcccttgag
ggtcgggaccctgagttaggcctgaagtctgtgcagaagctgctggatgccgtggacact
tacatccccgtgcccacccgggacctggagaagcctttcctgatgcccatagagacggtg
ttctccatccctggccgtggcactgtggtgtcaggtacgctagagcgtggtattttaaag
aagggagatgactgtgagctcctgggacatagcaagaatattcgcactgtggtgacaggc
attgagatgttccacaagagcctggagagggctgaggccggagataacctcggggccctg
gtccgaggcttgaagagggaggatgtacgacggggcctggtcatggtcaagccgggttcc
gtccaagcgtgccccaaggtggaggcccaggtttacatcctcagtaaggaggaaggtggc
cgccacaagccctttgtgtcccactacatgcctatcatgttctccatgacttgggacatg
gcctgtcgggttatcctgcccccggggaaggagctcgccatgccaggggaggacctgaag
ctcaacctgatcttgcggcagccaatgatcttagagaaaggccagcgtttcacccttcga
gatggcaaccggaccatcggcaccggtctagttaccgacacgccggccatgactgaggag
gagaagaacctcaagtggaattaa

DBGET integrated database retrieval system