KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051366
Entry
101051366         CDS       T04350                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04064  NF-kappa B signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04115  p53 signaling pathway
sbq04140  Autophagy - animal
sbq04141  Protein processing in endoplasmic reticulum
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04217  Necroptosis
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04340  Hedgehog signaling pathway
sbq04510  Focal adhesion
sbq04621  NOD-like receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04915  Estrogen signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05014  Amyotrophic lateral sclerosis
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05215  Prostate cancer
sbq05222  Small cell lung cancer
sbq05226  Gastric cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101051366 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101051366 (BCL2)
   04630 JAK-STAT signaling pathway
    101051366 (BCL2)
   04064 NF-kappa B signaling pathway
    101051366 (BCL2)
   04066 HIF-1 signaling pathway
    101051366 (BCL2)
   04071 Sphingolipid signaling pathway
    101051366 (BCL2)
   04151 PI3K-Akt signaling pathway
    101051366 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101051366 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    101051366 (BCL2)
   04215 Apoptosis - multiple species
    101051366 (BCL2)
   04217 Necroptosis
    101051366 (BCL2)
   04115 p53 signaling pathway
    101051366 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101051366 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101051366 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101051366 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    101051366 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101051366 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    101051366 (BCL2)
   04722 Neurotrophin signaling pathway
    101051366 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101051366 (BCL2)
   05206 MicroRNAs in cancer
    101051366 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101051366 (BCL2)
   05226 Gastric cancer
    101051366 (BCL2)
   05215 Prostate cancer
    101051366 (BCL2)
   05222 Small cell lung cancer
    101051366 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101051366 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    101051366 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101051366 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101051366 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101051366 (BCL2)
   05152 Tuberculosis
    101051366 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101051366 (BCL2)
   05161 Hepatitis B
    101051366 (BCL2)
   05162 Measles
    101051366 (BCL2)
   05168 Herpes simplex virus 1 infection
    101051366 (BCL2)
   05169 Epstein-Barr virus infection
    101051366 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101051366 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101051366 (BCL2)
   01524 Platinum drug resistance
    101051366 (BCL2)
   01522 Endocrine resistance
    101051366 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101051366 (BCL2)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101051366 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 101051366
NCBI-ProteinID: XP_010335171
LinkDB
Position
Unknown
AA seq 221 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPGPA
APRDPVARTPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELF
RDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAF
VELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagatgtgggcgccgcgccccca
ggcgccgcccccgcgccgggcatcttctcctcccagcccgggcacacgcccggtcccgct
gcgccccgggaccctgtcgccaggaccccagtgccacctgtggtccacctgaccctccgc
caggccggcgacgacttctcccgccgctatcgccgcgacttcgccgagatgtccagccag
ctgcacctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttc
agggacggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgt
gtggagagcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgacc
gagtacctgaaccggcacctgcacacctggatccaggataacggaggctgggatgccttt
gtggaactgtatggccccagcatgcggcctctgtttgatttctcctggctgtctctgaag
actctgctcagcttggccctggtgggagcttgcatcaccctgggtgcctatctgggccac
aagtga

DBGET integrated database retrieval system