KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051429
Entry
101051429         CDS       T04350                                 

Gene name
FADS2
Definition
(RefSeq) fatty acid desaturase 2
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00592  alpha-Linolenic acid metabolism
sbq01040  Biosynthesis of unsaturated fatty acids
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    101051429 (FADS2)
   01040 Biosynthesis of unsaturated fatty acids
    101051429 (FADS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101051429 (FADS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101051429 (FADS2)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     101051429 (FADS2)
Lipid biosynthesis proteins [BR:sbq01004]
 Desaturase
  Front-end
   101051429 (FADS2)
SSDB
Motif
Pfam: FA_desaturase Cyt-b5 Jiv90
Other DBs
NCBI-GeneID: 101051429
NCBI-ProteinID: XP_003920256
UniProt: A0A2K6UA82
LinkDB
Position
Unknown
AA seq 444 aa
MGKGGNQGEGVAEREATMPTFSWEEIQKHNLRTDKWLVIDRKVYNITEWSHRHPGGQRVI
GHYAGEDATDVFHAFHPNLKFVRKFLKPLLIGELAPEEPSQDRGKNSQITEDFRVLRKTA
EEMNLFKTNHMFFFLHLAHIVALESIGWFTIFYFGNGWIPTLITAFVLATSQAQAGWLQH
DYGHLSVYRKPMWNHIAHKFVIGHLKGASANWWNHRHFQHHAKPNVFQKDPDVNMLHTFV
LGRWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPVYFQYQIFMTMISRKDWVDLVWAI
SYYTRFFVTYIPFYGILGALLFLNFVRFLESHWFVWVTQMNHIVMEIDQEPYRDWFSSQL
SATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKVAPLVKSLCAKHGIDYQEKPLL
RALLDIIRSLKKSGELWLDAYLHK
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggggaagggggggaaccagggcgagggggtcgccgagcgcgaggcgacgatgcccacc
ttcagctgggaggagattcagaagcataacctgcgcaccgacaagtggctggtcattgac
cgcaaggtttacaacatcaccgaatggtcccaccggcacccggggggccaaagggtcatc
gggcactacgctggagaagatgcaacggatgtcttccatgccttccaccctaacctgaaa
ttcgtgcgcaagttcttgaaacccctgcttattggcgagctggccccggaggagcccagc
caggaccgtggcaagaactctcagatcactgaggacttccgggtcctgaggaagacggct
gaggagatgaacctgttcaagaccaaccacatgttcttcttcctccacctggcccacatc
gttgccttggagagcattgggtggttcaccatcttttactttggcaatggctggattcct
accctcatcacagcctttgtccttgctacctctcaggcccaagctggatggctgcaacat
gattatggccacctgtctgtctacaggaaacccatgtggaaccacattgcccacaaattc
gtcattggccacttaaagggtgcctccgccaactggtggaatcatcgccacttccagcac
cacgccaagcctaacgtcttccagaaggatcccgacgtgaacatgctgcacacgttcgtc
ctgggcagatggcagcccatcgagtacggcaagaagaagctgaaatacctgccctacaat
caccagcacgaatacttcttcctgattgggccgccgctgctaatccctgtgtatttccag
taccagatcttcatgaccatgatctcccgcaaggactgggtggacctggtctgggccatc
agctactacacccggttcttcgtcacctacatccctttctacggcatcctgggagctctc
cttttcctcaacttcgtcaggttcctggagagccactggtttgtgtgggtcacacagatg
aaccacatcgtcatggagattgaccaagagccctaccgtgactggttcagtagccagctg
tcagccacctgcaatgtggagcagtccttcttcaacgactggttcagcggacaccttaac
ttccagattgagcaccacctcttccccaccatgccccggcacaatctccacaaggtcgcc
ccactggtgaagtctctgtgtgccaagcatggcatcgactaccaggagaagccgctgctg
agggccctgctggacatcatcaggtccctaaagaagtccggggagctgtggctggacgcc
tacctccacaaatga

DBGET integrated database retrieval system