KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051525
Entry
101051525         CDS       T04350                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04115  p53 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04370  VEGF signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05134  Legionellosis
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101051525 (CASP9)
   04151 PI3K-Akt signaling pathway
    101051525 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101051525 (CASP9)
   04215 Apoptosis - multiple species
    101051525 (CASP9)
   04115 p53 signaling pathway
    101051525 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101051525 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101051525 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101051525 (CASP9)
   05212 Pancreatic cancer
    101051525 (CASP9)
   05215 Prostate cancer
    101051525 (CASP9)
   05213 Endometrial cancer
    101051525 (CASP9)
   05222 Small cell lung cancer
    101051525 (CASP9)
   05223 Non-small cell lung cancer
    101051525 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101051525 (CASP9)
   05012 Parkinson disease
    101051525 (CASP9)
   05014 Amyotrophic lateral sclerosis
    101051525 (CASP9)
   05016 Huntington disease
    101051525 (CASP9)
   05020 Prion disease
    101051525 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    101051525 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101051525 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101051525 (CASP9)
   05152 Tuberculosis
    101051525 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101051525 (CASP9)
   05161 Hepatitis B
    101051525 (CASP9)
   05160 Hepatitis C
    101051525 (CASP9)
   05164 Influenza A
    101051525 (CASP9)
   05162 Measles
    101051525 (CASP9)
   05168 Herpes simplex virus 1 infection
    101051525 (CASP9)
   05163 Human cytomegalovirus infection
    101051525 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101051525 (CASP9)
   05169 Epstein-Barr virus infection
    101051525 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101051525 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101051525 (CASP9)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     101051525 (CASP9)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101051525 (CASP9)
Peptidases and inhibitors [BR:sbq01002]
 Cysteine peptidases
  Family C14: caspase family
   101051525 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 101051525
NCBI-ProteinID: XP_003935028
UniProt: A0A2K6S316
LinkDB
Position
Unknown
AA seq 401 aa
MDEADRLLLRRHRRLLVEELRVDQLWDALLSRELFKPHMIEDIQRAGCGSRRDQARQLIT
DLESRGSQALPLFISCLEETGQCMLASILQTNRQTEKFLIPKTKDLRPETPRPVDPGCRG
FGDGGAPGNPRGNADLAYVMSSEPCGHCLIINNVNFSDESRLSTRIGSDVDCGKLQLRFS
SLHFMVEVKRDLTAKEMGLALLELARRDHSALDCCVVVILSHGCQASHLQFPGAVYGTDG
YPVSLEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEEESPGSNPESD
ATPFQEDAWTFDQVDAVSSLPTPSDIFVSYSTFPGFVSWREPKRGSWYVETLDDIFEQWA
HSEDLQSLLLRVANAVSGKGIYKQMPGFFNFLRKKLFFKTS
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggacgaagcggaccggctgcttctgcggcggcaccggcggctgctggtggaggagctg
cgggtggaccagctctgggacgccctgctgagccgcgagctgttcaagccccacatgatc
gaggacatccagcgggcaggctgtggatctcggcgggatcaggccaggcagctgatcaca
gatctagagtctcgggggagtcaagcccttcctttgttcatctcctgcttagaggagaca
ggccagtgcatgttggcttcgatcctgcaaactaataggcaaacagaaaagttcttgatt
cccaaaacaaaggatctcagaccagaaacacccagaccagtggaccctggttgtagagga
ttcggtgatggcggtgctcctgggaatccgaggggaaatgcggatttggcttatgtcatg
agctcggagccctgtggccactgcctcattatcaacaatgtgaacttcagcgacgagtcc
aggctcagcacccgcatcggctccgacgtcgactgtgggaagttgcagctccgcttctcc
tcactgcatttcatggtggaggtgaagcgcgaccttactgccaaggaaatggggctggct
ttgctggagctggcgcggcgggaccacagtgctttggactgctgtgtggtggtcatcctc
tctcatggctgtcaggccagccacctgcagtttccaggggctgtctacggcacagatgga
taccctgtgtcacttgagaagattgtgaatatcttcaatgggaccagctgccccagcctg
ggagggaagcccaagctctttttcatccaggcctgtggtggggagcagaaagaccatggg
tttgaggtggcctccacttcccctgaagaggagtcccctggcagtaaccccgagtcagat
gccaccccattccaggaagatgcgtggacctttgaccaggtggatgccgtatctagtttg
cccacacccagtgacatctttgtgtcctactctactttcccaggttttgtctcctggagg
gagcccaagagaggttcctggtatgtggagaccctggacgacatctttgagcagtgggct
cactctgaagacctgcagtccctgctgctcagggtcgctaatgctgtttcggggaaaggg
atttataaacagatgcctggtttctttaatttcctccggaaaaaacttttctttaaaaca
tcataa

DBGET integrated database retrieval system