KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051959
Entry
101051959         CDS       T04350                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04015  Rap1 signaling pathway
sbq04062  Chemokine signaling pathway
sbq04137  Mitophagy - animal
sbq04144  Endocytosis
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04530  Tight junction
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04625  C-type lectin receptor signaling pathway
sbq04727  GABAergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04810  Regulation of actin cytoskeleton
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq05100  Bacterial invasion of epithelial cells
sbq05135  Yersinia infection
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05219  Bladder cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101051959 (SRC)
   04015 Rap1 signaling pathway
    101051959 (SRC)
   04370 VEGF signaling pathway
    101051959 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101051959 (SRC)
   04137 Mitophagy - animal
    101051959 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101051959 (SRC)
   04520 Adherens junction
    101051959 (SRC)
   04530 Tight junction
    101051959 (SRC)
   04540 Gap junction
    101051959 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101051959 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101051959 (SRC)
   04625 C-type lectin receptor signaling pathway
    101051959 (SRC)
   04062 Chemokine signaling pathway
    101051959 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101051959 (SRC)
   04915 Estrogen signaling pathway
    101051959 (SRC)
   04917 Prolactin signaling pathway
    101051959 (SRC)
   04921 Oxytocin signaling pathway
    101051959 (SRC)
   04926 Relaxin signaling pathway
    101051959 (SRC)
   04919 Thyroid hormone signaling pathway
    101051959 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    101051959 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101051959 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    101051959 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101051959 (SRC)
   05203 Viral carcinogenesis
    101051959 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    101051959 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101051959 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101051959 (SRC)
   05152 Tuberculosis
    101051959 (SRC)
   05100 Bacterial invasion of epithelial cells
    101051959 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101051959 (SRC)
   05168 Herpes simplex virus 1 infection
    101051959 (SRC)
   05163 Human cytomegalovirus infection
    101051959 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101051959 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101051959 (SRC)
   01522 Endocrine resistance
    101051959 (SRC)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101051959 (SRC)
Protein kinases [BR:sbq01001]
 Non-receptor tyrosine kinases
  SRC family
   101051959 (SRC)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101051959 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    101051959 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101051959 (SRC)
  Macropinocytosis
   Kinases
    101051959 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 101051959
NCBI-ProteinID: XP_010345150
LinkDB
Position
Unknown
AA seq 553 aa
MGSNKSKPKDASQRRRSLEPAENAHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESER
LLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQF
NSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGE
VWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEY
MSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVC
KVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGR
VPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYF
TSTEPQYQPGENL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgcgcatggagccggtgggggcgctttccccgcctcgcagacccccagcaag
ccggcctcggccgacggccaccgcggccccagcgcggccttcgcccccgctgccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagatcgtcaacaacacgaggaaggtg
gatgtcagccagacctggttcacattcagatggctgcaaagagagggagactggtggctg
gcccactcgctcagcacgggacagacaggctacatccccagcaactacgtggcgccctcc
gactccatccaggccgaggagtggtattttggcaagatcaccaggcgggagtcagaacgg
ctattgctcaatgcggagaacccgagggggacattcctagtgcgggaaagtgagaccacg
aaaggtgcctactgcctctcagtgtccgacttcgacaatgccaagggcctcaacgtgaag
cactacaagatccgcaagctggacagcggcggcttctacatcacctcccgcacccagttc
aacagcctgcagcagctggtggcatactactccaaacatgctgacggcctgtgccaccgc
ctcaccaccgtgtgccccacgtccaagccgcagactcagggcctggccaaggatgcctgg
gagatccctcgggagtctctgcggctggaggtcaagctgggccagggctgctttggagag
gtgtggatgggaacctggaatggcaccaccagggtggccatcaaaaccctgaagccaggc
accatgtctccggaggccttcctgcaggaggcccaggtcatgaagaaactgaggcatgaa
aagctggtgcagctgtatgctgtggtttcggaggagcccatctacattgtcacggagtac
atgagcaaggggagtttgctggactttctcaagggggaaacgggcaagtacctgcggctg
cctcagctggtggacatggctgctcagatcgcctccggcatggcgtatgtggagcggatg
aactacgtccatcgggaccttcgtgcagccaacatcctcgtgggagagaacttggtgtgc
aaagtggccgacttcgggctggctcggctcatcgaagacaatgagtacacagcccggcaa
ggtgccaaattccccatcaagtggacggctccggaagctgccctctatggccggttcacc
atcaagtcggacgtgtggtccttcgggatcctgctgacggagctcaccacaaaggggcgg
gtgccctaccctgggatggtgaaccgagaggtgctggaccaggtggagcggggctaccgg
atgccctgcccgcccgagtgtcctgagtccctgcacgacctcatgtgccagtgctggcgg
aaggagcccgaggagcggcccactttcgagtacctgcaggccttcctggaagactacttc
acgtccaccgagccccagtaccagcctggagagaacctctag

DBGET integrated database retrieval system