KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051991
Entry
101051991         CDS       T04350                                 

Gene name
IRF9
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04621  NOD-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq05160  Hepatitis C
sbq05162  Measles
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101051991 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101051991 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101051991 (IRF9)
   04625 C-type lectin receptor signaling pathway
    101051991 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101051991 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101051991 (IRF9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101051991 (IRF9)
   05171 Coronavirus disease - COVID-19
    101051991 (IRF9)
   05164 Influenza A
    101051991 (IRF9)
   05162 Measles
    101051991 (IRF9)
   05168 Herpes simplex virus 1 infection
    101051991 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101051991 (IRF9)
   05169 Epstein-Barr virus infection
    101051991 (IRF9)
   05165 Human papillomavirus infection
    101051991 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101051991 (IRF9)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    101051991 (IRF9)
SSDB
Motif
Pfam: IRF-3
Other DBs
NCBI-GeneID: 101051991
NCBI-ProteinID: XP_010333313
LinkDB
Position
Unknown
AA seq 364 aa
MMQLRPCSGFPGSMQASRTSGRIRMLPSSRPGQYLRESIRRGTQEAPLPGRLAYAVHSTR
VLNLRKSLRGAAWMLLSPTRCIACCHQEPSLEGLRNHHQSDSTXSVSSERKEEEGAMQNC
TLSPSVLQDSLNNEEEGASRGAVHSDIRSNSSSSSSSSPEPQEGTDTTDAPLQGDQVFLE
FLLPPESDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQ
RLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQDPPGPGPHLLPSNECVELFRTAYFC
RDLARYFQGLGPPPKFQVTLNFWEESCGPSHTPQNLITVKMEQAFARHLLEETPEQEAAI
LSLV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgatgcagctaagaccatgttccggattccctggaagcatgcaggcaagcaggacttcc
gggaggatcaggatgctgccttcttcaaggcctgggcaatatttaagggaaagtataagg
agggggacacaggaggccccgctgcctggaagactcgcctacgctgtgcactcaacaaga
gtcctgaatttgaggaagtccctgagaggggccgcatggatgttgctgagccctacaagg
tgtatcgcctgctgccaccaggaaccctctctggagggactcagaaatcaccatcaaagc
gacagcacangttctgtgtcttctgagaggaaagaggaagagggtgccatgcagaactgt
acactcagtccctctgtgctccaggactccctcaataatgaagaggagggagccagtagg
ggagcagtccattcagacatcaggagcaacagcagcagcagcagcagcagcagccctgag
ccacaggaaggtacagacacaactgatgcccccttacaaggggatcaggtgttcctggag
tttctgcttcctccagagtccgactactcactgctgctcaccttcatctacaatgggcgc
gtggtgggcgaggcccaggtgcaaagcctggactgccgccttgtggctgagccctcaggc
tctgagagcagcatggagcaggtgctattccccaagcctggtccactggagcctacacag
cgcctgctgagtcagcttgagaggggcatcctggtggccagcaacccccgaggcctcttc
gtgcagcgcctttgccccatccccatctcctggaatgcaccccaggatccacctgggcca
ggcccacatctgctgcccagcaacgagtgcgtggagctcttcagaactgcctacttctgc
agagacttggccaggtacttccagggcctgggccccccacccaagttccaggtaacactg
aatttctgggaggagagctgtggccccagccatactccacagaatcttatcacggtgaag
atggagcaggcttttgcccgacacttactggaggagactccagagcaggaggcagccatt
ctgtccctggtgtag

DBGET integrated database retrieval system