KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052056Help
Entry
101052056         CDS       T04350                                 

Gene name
WHSC1
Definition
(RefSeq) histone-lysine N-methyltransferase NSD2 isoform X1
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00310  Lysine degradation
sbq05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101052056 (WHSC1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    101052056 (WHSC1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101052056 (WHSC1)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101052056 (WHSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box HMG_box_2 zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 101052056
NCBI-ProteinID: XP_003934751
UniProt: A0A2K6SJE0
LinkDB All DBs
Position
Unknown
AA seq 1368 aa AA seqDB search
MEFSIKQSPLSVQSVVKCIKMKQTPEILGSTNGKTPSCEVNRECSVFLSKAQLSSSLQEG
VMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESPEMKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDGAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESSGEMAESSGVSEEAAENPKSVREEGIPMKRRRRAKLCSSAETLESEPNIEK
STPQKTAEADPRRGVGSPPGRKKATVSTPRSRKGDAASQFLVFCQKHRDEVVAEHPDASG
EEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGHINGKKRNHTKRTQDPPEDLE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKR
NRASTAASSALGFSKSSSPSASLTENEVSDSPGDEPSESPYESADETQTEVSVSSKKSER
GVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECTSGIHSCFVC
KENKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKG
KMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVSWCFVCSKG
GSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKN
ALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKP
TDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAK
RDIRKGEFVNEYVGEVIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFM
NHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSG
FLGDRPKTSTTLSSEEKGKKAKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCT
KAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGR
SYCCEHDLGAASVRSTKTEKPPPEPGKPKGKRRRRRGAAGPAFSRGRA
NT seq 4107 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagcatcaagcagagtcccctttctgttcagagtgttgtaaagtgcataaag
atgaagcagacaccagaaatcctcggcagtaccaacgggaagactccgagctgtgaggtg
aatcgcgagtgttctgtgttcctcagcaaagcccagctctccagcagcctgcaggagggg
gtcatgcagaagtttaacggccatgacgccctgccctttattccagctgacaagctgaaa
gatcttacttcccgggtgtttaatggagaacctggtgcacatgatgccaaattgcgtttt
gagtccccagaaatgaaagggattgggacaccacctaacactacccctatcaaaaatggc
tctccagaaattaagctgaaaatcaccaaaacatacatgaatgggaagcctctttttgaa
tcttccatttgtggtgacggtgctgctgatgtatctcagtcagaagaaaatggacaaaaa
ccagaaaacaaggcgagaaggaacaggaagaggagcataaaatatgactccttgctggag
cagggccttgtcgaagcagctctggtgtctaagatctcaagtccttcagataaaaagatt
ccagctaagaaagagtcttgtccaaacactggcagagacaaagaccacctgttgaaatac
aacgtcggtgatttggtgtggtccaaagtgtcgggttatccttggtggccttgcatggtt
tctgcagatccactccttcacagctataccaaacttaaaggtcagaaaaagagtgcacgc
cagtatcacgtacagttctttggtgacgccccagaaagagcttggatatttgagaagagc
cttgtagcttttgaaggagaaggacagtttgaaaaattatgccaggaaagtgccaagcag
gcacccacgaaagctgagaaaattaagctattgaaacctatttcagggaaattgagggcc
cagtgggaaatgggtattgttcaggcagaagaagctgcaagcatgtcagtggaggagcgg
aaagccaagttcacctttctatatgtgggagaccagcttcatctcaaccctcaagtagcc
aaggaggctggcattgctgcagaatcttcaggagaaatggcagaatcctcaggagttagt
gaagaagctgctgaaaaccccaagtctgtgagagaagagggcattcccatgaagagaagg
cggagggccaaactgtgtagctctgcggagaccctggagagtgagcccaacatagagaag
agtactcctcaaaagacagcagaggctgaccccagaagaggtgtagggtctcctcctggg
aggaagaaggccacagtctccacaccacgaagcaggaagggagatgcagcatcccaattt
ttagtcttctgtcaaaaacacagggatgaggtggtggctgagcacccagatgcttcaggt
gaggagattgaagagctgctcaggtcacagtggagtctgctgagtgagaagcagagagcg
cgttacaacaccaagtttgccctggtggcccctgtccaggctgaagaagactctggtcac
ataaatgggaaaaaaagaaaccacacaaagaggacacaggaccctccagaagatcttgaa
gctgaagacacacccaggaaaagactcaggacagacaagcacagtcttcggaagagagac
acaatcactgacaaaacggccagaacaagctcttacaaggccatggaggcagcctcctcg
ctcaagagccaggcagcaacgaaaaatctgtctgatgcatgtaaaccactgaagaagcga
aatcgggcttccacggcagcatcttcagctcttgggtttagcaaaagttcatctccttct
gcatccttaactgagaatgaggtctcggacagcccaggagacgagccctcagagtccccg
tacgaaagtgccgacgaaacgcaaactgaagtgtctgtctcatccaaaaagtctgagcga
ggagtgacagccaaaaaggaatatgtgtgccagctgtgtgagaagccaggcagcctcctg
ctgtgtgaaggaccctgctgtggagctttccacctcgcctgccttgggctttcccggagg
ccagaagggaggttcacctgcagcgagtgtacctcagggattcactcatgtttcgtgtgt
aaagagaacaagaccgatgttaagcgctgtgtggtaactcagtgtggaaaattttatcac
gaggcttgtgtgaaaaaataccctctgactgtgtttgagagccgagggttccgctgccct
ctccacagctgtgtgagctgccacgcttccaacccttcaaacccaaggccgtcgaaaggt
aaaatgatgcggtgtgtccgctgccctgttgcctatcacagcggggatgcttgtctggcg
gcggggtgctcagtgatcgcctccaacagcatcatctgcacggcccatttcactgctcgg
aaagggaagcggcaccacgcccacgttaatgtgagctggtgcttcgtgtgctccaaaggg
gggagccttctgtgctgtgagtcttgcccggcggccttccaccctgactgcctgaacatc
gagatgcctgacggcagctggttctgcaatgactgcagggctgggaagaagctgcacttc
caggatatcatttgggtgaaactggggaactacagatggtggccggcagaagtttgccat
cccaaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccctgtg
tttttctttgggtctaaagattattactggacgcatcaggcgcgagtgttcccgtacatg
gagggggaccggggcagccgctaccagggggtcagagggatcggaagagtcttcaaaaac
gcactgcaagaagctgaagctcgttttcgtgaaattaagcttcagagggaagcccgagaa
acacaggagagtgagcgcaagcccccaccatacaagcatatcaaggtgaataagccttat
gggaaagtccagatctacacagcggatatttctgaaatcccgaagtgtaactgcaagccc
acagatgagaatccctgtggctttgactcggagtgtttgaacaggatgctcatgtttgag
tgccacccgcaggtgtgtcctgcaggcgagttctgtcagaaccagtgcttcaccaagcgc
cagtacccagagaccaagatcatcaagacagatggcaaagggtggggcctggtcgccaag
agggacatcagaaagggagaatttgttaacgagtacgtcggggaggtgattgacgaggag
gagtgcatggccagaatcaagcatgcgcatgagaacgacatcacccacttctacatgctc
actatagacaaggaccgtataattgatgctggacccaaaggaaactactctcgatttatg
aatcacagctgccagcccaactgtgagaccctcaagtggacagtgaatggggacactcgt
gtgggcctgttcgccgtctgtgacattccggcagggacagagctgacttttaactacaac
ctcgattgtttgggcaatgaaaaaacagtctgccggtgtggagcctccaattgcagtgga
ttcctcggggacagaccaaagacctcgacaaccctttcttcagaggaaaaaggcaaaaag
gccaagaagaaaaccaggcggcgccgagccaaaggggaagggaagaggcagtcggaggat
gagtgcttccgctgtggcgatggtgggcagctggtgctgtgtgaccgcaagttctgcacc
aaggcctaccacctgtcctgcctgggcctaggcaagcggcccttcgggaagtgggaatgt
ccttggcatcattgtgacgtgtgtggcaaaccttcgacttcattttgccacctctgcccc
aattcgttctgtaaggagcaccaggatgggacagccttcagctgcaccccggacgggcgg
tcctactgctgtgagcatgacttgggggcagcgtcggtcagaagcaccaagactgagaag
ccccccccagagccagggaagccgaaggggaagaggcggcggcggaggggggcagccggc
cctgccttcagcagagggcgagcgtga

DBGET integrated database retrieval system