KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052068
Entry
101052068         CDS       T04350                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04144  Endocytosis
sbq04150  mTOR signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04350  TGF-beta signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04530  Tight junction
sbq04611  Platelet activation
sbq04621  NOD-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04921  Oxytocin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04972  Pancreatic secretion
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05152  Tuberculosis
sbq05163  Human cytomegalovirus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101052068 (RHOA)
   04015 Rap1 signaling pathway
    101052068 (RHOA)
   04310 Wnt signaling pathway
    101052068 (RHOA)
   04350 TGF-beta signaling pathway
    101052068 (RHOA)
   04072 Phospholipase D signaling pathway
    101052068 (RHOA)
   04071 Sphingolipid signaling pathway
    101052068 (RHOA)
   04024 cAMP signaling pathway
    101052068 (RHOA)
   04022 cGMP-PKG signaling pathway
    101052068 (RHOA)
   04150 mTOR signaling pathway
    101052068 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101052068 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101052068 (RHOA)
   04520 Adherens junction
    101052068 (RHOA)
   04530 Tight junction
    101052068 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101052068 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101052068 (RHOA)
   04621 NOD-like receptor signaling pathway
    101052068 (RHOA)
   04625 C-type lectin receptor signaling pathway
    101052068 (RHOA)
   04660 T cell receptor signaling pathway
    101052068 (RHOA)
   04670 Leukocyte transendothelial migration
    101052068 (RHOA)
   04062 Chemokine signaling pathway
    101052068 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101052068 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    101052068 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101052068 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    101052068 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101052068 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    101052068 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052068 (RHOA)
   05206 MicroRNAs in cancer
    101052068 (RHOA)
   05205 Proteoglycans in cancer
    101052068 (RHOA)
   05203 Viral carcinogenesis
    101052068 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101052068 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101052068 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101052068 (RHOA)
   05135 Yersinia infection
    101052068 (RHOA)
   05133 Pertussis
    101052068 (RHOA)
   05152 Tuberculosis
    101052068 (RHOA)
   05100 Bacterial invasion of epithelial cells
    101052068 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101052068 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101052068 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101052068 (RHOA)
   04031 GTP-binding proteins [BR:sbq04031]
    101052068 (RHOA)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    101052068 (RHOA)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101052068 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   101052068 (RHOA)
  Exosomal proteins of colorectal cancer cells
   101052068 (RHOA)
  Exosomal proteins of bladder cancer cells
   101052068 (RHOA)
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    101052068 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 101052068
NCBI-ProteinID: XP_010345492
LinkDB
Position
Unknown
AA seq 233 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFATWSPFVALCEEYGLDKLLRT
KGAFIVGFPDSSLAIMSSRIKLELLWLFFPLQVELALWDTAGQEDYDRLRPLSYPDTDVI
LMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK
PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
NT seq 702 nt   +upstreamnt  +downstreamnt
atggctgccattcggaagaaactggtaatcgttggtgatggagcctgtggaaaaacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgct
acctggtctccgtttgtggcactgtgtgaggaatatggattagataagctgctccgaact
aaaggggccttcattgtagggtttcctgatagttctttggccatcatgagtagtaggatt
aagcttgagctcttgtggttgtttttcccattacaggtagagttggctttgtgggacaca
gctggacaagaagattatgatcgcctgaggcccctctcctacccagacaccgatgttatc
ctgatgtgtttttccatcgacagtcctgatagtttagaaaacatcccagaaaagtggact
ccggaagtcaagcatttctgtcccaacgtgcccattatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggaacctgtgaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104650592
Entry
104650592         CDS       T04350                                 

Definition
(RefSeq) ras-like GTP-binding protein O-RHO
  KO
K04513  Ras homolog gene family, member A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04144  Endocytosis
sbq04150  mTOR signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04350  TGF-beta signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04530  Tight junction
sbq04611  Platelet activation
sbq04621  NOD-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04921  Oxytocin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04972  Pancreatic secretion
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05152  Tuberculosis
sbq05163  Human cytomegalovirus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104650592
   04015 Rap1 signaling pathway
    104650592
   04310 Wnt signaling pathway
    104650592
   04350 TGF-beta signaling pathway
    104650592
   04072 Phospholipase D signaling pathway
    104650592
   04071 Sphingolipid signaling pathway
    104650592
   04024 cAMP signaling pathway
    104650592
   04022 cGMP-PKG signaling pathway
    104650592
   04150 mTOR signaling pathway
    104650592
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104650592
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104650592
   04520 Adherens junction
    104650592
   04530 Tight junction
    104650592
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104650592
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104650592
   04621 NOD-like receptor signaling pathway
    104650592
   04625 C-type lectin receptor signaling pathway
    104650592
   04660 T cell receptor signaling pathway
    104650592
   04670 Leukocyte transendothelial migration
    104650592
   04062 Chemokine signaling pathway
    104650592
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104650592
   04928 Parathyroid hormone synthesis, secretion and action
    104650592
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104650592
  09154 Digestive system
   04972 Pancreatic secretion
    104650592
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104650592
  09158 Development and regeneration
   04360 Axon guidance
    104650592
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104650592
   05206 MicroRNAs in cancer
    104650592
   05205 Proteoglycans in cancer
    104650592
   05203 Viral carcinogenesis
    104650592
  09162 Cancer: specific types
   05210 Colorectal cancer
    104650592
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104650592
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104650592
   05135 Yersinia infection
    104650592
   05133 Pertussis
    104650592
   05152 Tuberculosis
    104650592
   05100 Bacterial invasion of epithelial cells
    104650592
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104650592
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    104650592
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    104650592
   04031 GTP-binding proteins [BR:sbq04031]
    104650592
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    104650592
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104650592
  Exosomal proteins of other body fluids (saliva and urine)
   104650592
  Exosomal proteins of colorectal cancer cells
   104650592
  Exosomal proteins of bladder cancer cells
   104650592
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    104650592
SSDB
Motif
Pfam: Ras Roc DUF4585
Other DBs
NCBI-GeneID: 104650592
NCBI-ProteinID: XP_010332082
LinkDB
Position
Unknown
AA seq 112 aa
MCLLFVFSKDQFPAGFAPRVFQNDVAHIEVDGTRVELTMWDTARQEDDDGLRPLFDPDTG
AYWCVSSLTTLRAENTSRSHGVQTSSNSVPACSSSWLGTSRIFGMMCTQGGS
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtgcttgctcttcgtcttcagcaaagaccagttcccagcggggttcgcccccagagtg
tttcagaacgacgtggcccatatcgaggtggacgggacgcgggtagagctgaccatgtgg
gacacagcccggcaggaggatgatgatggcctgaggcccctctttgacccagacacgggt
gcttactggtgtgtttcttcgctgacaaccctgagagctgagaacacatcccggagccac
ggagtccagacgtcaagcaactctgtcccagcgtgctcatcatcctggttgggaacaagc
aggatcttcggaatgatgtgcacgcaaggtgggagctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104652261
Entry
104652261         CDS       T04350                                 

Gene name
RHOC
Definition
(RefSeq) rho-related GTP-binding protein RhoC
  KO
K04513  Ras homolog gene family, member A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04144  Endocytosis
sbq04150  mTOR signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04350  TGF-beta signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04530  Tight junction
sbq04611  Platelet activation
sbq04621  NOD-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04921  Oxytocin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04972  Pancreatic secretion
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05152  Tuberculosis
sbq05163  Human cytomegalovirus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104652261 (RHOC)
   04015 Rap1 signaling pathway
    104652261 (RHOC)
   04310 Wnt signaling pathway
    104652261 (RHOC)
   04350 TGF-beta signaling pathway
    104652261 (RHOC)
   04072 Phospholipase D signaling pathway
    104652261 (RHOC)
   04071 Sphingolipid signaling pathway
    104652261 (RHOC)
   04024 cAMP signaling pathway
    104652261 (RHOC)
   04022 cGMP-PKG signaling pathway
    104652261 (RHOC)
   04150 mTOR signaling pathway
    104652261 (RHOC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104652261 (RHOC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104652261 (RHOC)
   04520 Adherens junction
    104652261 (RHOC)
   04530 Tight junction
    104652261 (RHOC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104652261 (RHOC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104652261 (RHOC)
   04621 NOD-like receptor signaling pathway
    104652261 (RHOC)
   04625 C-type lectin receptor signaling pathway
    104652261 (RHOC)
   04660 T cell receptor signaling pathway
    104652261 (RHOC)
   04670 Leukocyte transendothelial migration
    104652261 (RHOC)
   04062 Chemokine signaling pathway
    104652261 (RHOC)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104652261 (RHOC)
   04928 Parathyroid hormone synthesis, secretion and action
    104652261 (RHOC)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104652261 (RHOC)
  09154 Digestive system
   04972 Pancreatic secretion
    104652261 (RHOC)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104652261 (RHOC)
  09158 Development and regeneration
   04360 Axon guidance
    104652261 (RHOC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104652261 (RHOC)
   05206 MicroRNAs in cancer
    104652261 (RHOC)
   05205 Proteoglycans in cancer
    104652261 (RHOC)
   05203 Viral carcinogenesis
    104652261 (RHOC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104652261 (RHOC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104652261 (RHOC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104652261 (RHOC)
   05135 Yersinia infection
    104652261 (RHOC)
   05133 Pertussis
    104652261 (RHOC)
   05152 Tuberculosis
    104652261 (RHOC)
   05100 Bacterial invasion of epithelial cells
    104652261 (RHOC)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104652261 (RHOC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    104652261 (RHOC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    104652261 (RHOC)
   04031 GTP-binding proteins [BR:sbq04031]
    104652261 (RHOC)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    104652261 (RHOC)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104652261 (RHOC)
  Exosomal proteins of other body fluids (saliva and urine)
   104652261 (RHOC)
  Exosomal proteins of colorectal cancer cells
   104652261 (RHOC)
  Exosomal proteins of bladder cancer cells
   104652261 (RHOC)
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    104652261 (RHOC)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB GTP_EFTU Gtr1_RagA
Other DBs
NCBI-GeneID: 104652261
NCBI-ProteinID: XP_010342338
LinkDB
Position
Unknown
AA seq 196 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRQDEHTRRELAKMKQVGAAAGWEPSGRKASFEGLQMGKGSFSPATAVLGEMVISPGEGG
HLRLYHQYLMMYQRVK
NT seq 591 nt   +upstreamnt  +downstreamnt
atggctgcaatccgaaagaagctggtgatcgtcggggatggtgcctgtgggaagacctgc
ctcctcatcgtcttcagcaaggatcagtttccagaagtctacgtgcctactgtctttgag
aactatattgcggacattgaagtggacggcaaacaggtggagctggctctgtgggacaca
gcaggacaggaagactacgatcgactgcggcctctctcctaccccgacactgatgtcatc
ctcatgtgcttctccatcgacagccccgacagcctggaaaacattcctgagaagtggacc
ccagaggtgaagcacttctgccccaacgtgcccatcatcctagtggggaataagaaggac
ctgaggcaagatgagcacaccaggagagagctggccaagatgaagcaggtgggtgcggct
gccgggtgggagccctcggggaggaaggcatcttttgaggggttgcagatgggcaaaggg
agcttctctccagctactgctgtgttaggggagatggtgatctctcctggtgagggagga
cacctacggttgtatcatcagtatctgatgatgtatcagagagtgaagtga

DBGET integrated database retrieval system