KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052117Help
Entry
101052117         CDS       T04350                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04614  Renin-angiotensin system
sbq04924  Renin secretion
sbq05142  Chagas disease (American trypanosomiasis)
sbq05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101052117 (ACE)
   04614 Renin-angiotensin system
    101052117 (ACE)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101052117 (ACE)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    101052117 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbq01002]
    101052117 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101052117 (ACE)
   04090 CD molecules [BR:sbq04090]
    101052117 (ACE)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101052117 (ACE)
Peptidases [BR:sbq01002]
 Metallo Peptidases
  Family M2
   101052117 (ACE)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101052117 (ACE)
CD molecules [BR:sbq04090]
 Proteins
  101052117 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 101052117
NCBI-ProteinID: XP_010328590
UniProt: A0A2K6TDC3
LinkDB All DBs
Position
Unknown
AA seq 1160 aa AA seqDB search
MSRTYSTAKVCLPNKTATCWSLDPELTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYED
FTALSNEASKQDGFSDTGAYWRSWYDSPTFEDDLEHLYHQLEPLYLNLHAFVRRALHRRY
GDRYINLRGPIPAHLLGDMWAQSWDNIYDMVVPFPDKPNLDVTITMLQQGWNATHMFRVA
EEFFVSLGLSPMPPEFWAESMLEKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLF
TVHHEMGHVQYYLQYKDQPVSLRKGANPGFHEAIGDVLALSVSTPAHLYKIGLLDHVTND
TESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPV
TRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHQALCQEAGYQGALHQCDIYQSTKAG
AKLRKVLQAGSSRPWQEVLKEMVGSDALDAQPLLDYFQPLTQWLQEQNQKNSEVLGWPEY
QWRPPLPNNYPEGIDLVTDEAEARKFVEEYDRTSQVVWNEYAEANWNYNTNITRETSSIL
LQKNMQIANYTLQYGTQARRFDVSHFQNTTIKRILKKVQDLERAALPAQELEEYNKILLD
METTYSVATVCHTNGSCLQLEPDLTNVMATSRKYEELLWAWKGWRDKTGRTILQFYPKYV
EFINKAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGA
QHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSATLMDTTEAMLKQGWTPRRMFKEADD
FFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVA
HHEMGHIQYFMQYKDLPVALRDGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGDSFE
HNINFLMKMALEKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPR
TQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQVAGHTGPLHKCDIYQSKEAGQR
LAAAMKLGFSQPWPEAMRLITGQPNMSASAMLSYFKPLLDWLRAENELHGEKLGWPQYNW
TPNSARSEGPFPDSGRVSFLGLDLEPQQARVGQWLLLFLGIALLVATLGLSQRLFSIRRH
SLRQPHHGPQFGSEVELRHS
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggacctactccaccgccaaggtctgcctccccaacaagactgccacctgctgg
tccctggacccagaactcaccaacatcctggcttcctcgagaagctacgccatgctcctg
tttgcctgggagggctggcacaacgccgcgggaatcccgctgaaaccgctgtatgaggat
ttcactgccctcagcaatgaagcctccaagcaggatggcttttcagacacgggggcctac
tggcgctcctggtatgactcccccaccttcgaggatgatctggagcacctctaccatcag
ctggagcccctctacctgaacctccatgccttcgtccgccgcgcactgcatcgccgatac
ggggacagatacatcaacctcaggggacccatccctgctcatctgctgggagacatgtgg
gcccagagctgggacaacatctacgacatggtggtgcctttcccagacaagcccaacctt
gatgtcactattactatgctgcagcagggctggaatgccacacacatgttccgggtggca
gaggagttcttcgtctccctggggctctcccccatgcctccagagttctgggcagagtcg
atgctggagaagccggccgacgggcgggaggtggtgtgccatgcctcagcttgggatttc
tacaatcggaaagacttcaggatcaagcagtgcacgcgggtcacgatggaccagctcttc
actgtacaccatgagatgggccacgtgcagtactacctacagtacaaggaccagcccgtc
tccctgcgcaagggcgccaaccccggcttccatgaggccatcggggacgtgctggcgctc
tcggtctccactcctgcacatctgtacaaaatcggcctactggatcatgtcactaatgac
acggaaagtgacatcaattacttgctaaagatggcactggaaaaaattgccttcctgccc
tttggctacttggtggaccagtggcgctggggggtctttagcgggcgtacccccccttcc
cgctacaacttcgactggtggtaccttcgaaccaagtatcaggggatctgtcctcctgtc
acccgaaatgaaacccactttgatgctggagcaaagtttcatgtcccaaatgtgacacca
tacatcaggtactttgtgagttttgtcctgcagttccagttccatcaagccctgtgccag
gaggcaggctatcagggtgcactgcaccagtgtgacatctaccagtccaccaaagcaggg
gccaagctccggaaggtgctgcaggctggctcctccaggccctggcaggaagtgctgaag
gagatggtcggctcagatgccctggatgcccagccactgctcgactacttccagccactc
acccagtggctgcaggagcagaaccagaagaacagcgaggtcctgggctggccagagtac
cagtggcgcccaccgttgcccaacaactacccggagggcattgacctggtgaccgatgag
gctgaggccaggaagttcgtggaggaatatgaccgaacatcccaggtggtgtggaacgag
tacgccgaggccaactggaattacaacaccaacatcaccagagagaccagcagcattcta
ctgcagaagaacatgcagatagccaactacacgctgcagtacggcacccaggccaggagg
tttgatgtgagccacttccagaacaccactatcaagcggatcctcaagaaggttcaggac
ctagaacgggcagcactgcctgcccaggagctggaggagtacaacaagatcctgctggac
atggaaaccacctacagcgtggccactgtgtgccacacgaatggcagctgcctacagctc
gagccagatctgacgaacgtgatggccacatcccggaaatatgaagaactgttatgggcg
tggaagggctggcgagacaagacggggagaaccatcctccagttttacccgaaatacgtg
gaatttatcaacaaggcagcccggctcaacggctatgtagatgcaggggactcctggagg
tctatgtacgagacgccatccctggagcaagacctggagcggctcttccaggagctgcag
ccgctctacctgaacctgcatgcctatgtgcgccgggccctgcaccgccactacggggcc
cagcacatcaacctggagggccccatccctgctcacttgctggggaacatgtgggcacag
acctggtccaacatctatgacttggtggtgcccttcccttcagccaccttgatggacacc
acagaggccatgctaaagcagggctggacgcccaggaggatgtttaaggaggctgatgat
ttcttcacctccttggggctgctgcccgtgcctcctgagttctggaacaagtcgatgctg
gaaaagccaaccgacgggcgggaggtggtctgccatgcctcggcctgggacttctacaac
ggcaaggacttccggatcaagcagtgcaccactgtgaacttggaggacctggtggtggcc
caccacgaaatgggccacatccagtatttcatgcagtacaaagacttgcctgtggccttg
agggacggtgccaaccccggcttccatgaggccattggcgacgtgctagccctctcagta
tctacacccaagcacctgcacagtctcaacctgctgagcagcgagggcgacagctttgag
cacaacatcaactttctgatgaagatggcgctggaaaagatcgccttcatccccttcagc
tatcttgtggatcagtggcgctggagggtatttgatggaagcatcaccaaggagaactac
aaccaggagtggtggagcctcaggctgaagtaccagggcctctgtcccccggtgcccagg
actcaaggtgactttgatccaggggccaagttccacattccttctagtgtgccttacatc
aggtacttcgtcagcttcatcatccagttccagttccatgaggccctgtgccaggtggct
ggccacacgggccccctgcataagtgtgacatctaccagtccaaggaggccgggcagcgc
ctggcggccgccatgaagctgggtttcagtcagccgtggccggaagccatgcggctgatc
acgggccagcccaacatgagcgcctcggccatgctgagctacttcaagccactgctggac
tggctccgtgcggagaacgagctgcacggggagaagctgggctggccgcagtacaactgg
acacccaactccgctcgctcagaagggcccttcccagacagcggccgcgtcagcttcctg
ggcctggacctggagccacagcaggcccgcgtgggccagtggctgctgctcttcctgggc
atcgccctgctggtggccaccctgggcctcagccagcggctcttcagcatccgccgccac
agcctccgccagccccaccacgggccccagtttggctcggaggtggagctgagacactcc
tga

DBGET integrated database retrieval system