KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052117Help
Entry
101052117         CDS       T04350                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04614  Renin-angiotensin system
sbq04924  Renin secretion
sbq05142  Chagas disease (American trypanosomiasis)
sbq05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101052117 (ACE)
   04614 Renin-angiotensin system
    101052117 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101052117 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    101052117 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbq01002]
    101052117 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101052117 (ACE)
   04090 CD Molecules [BR:sbq04090]
    101052117 (ACE)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101052117 (ACE)
Peptidases [BR:sbq01002]
 Metallo Peptidases
  Family M2
   101052117 (ACE)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101052117 (ACE)
CD molecules [BR:sbq04090]
 Proteins
  101052117 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 101052117
NCBI-ProteinID: XP_010328590
UniProt: A0A2K6TDC3
LinkDB All DBs
Position
Unknown
AA seq 1160 aa AA seqDB search
MSRTYSTAKVCLPNKTATCWSLDPELTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYED
FTALSNEASKQDGFSDTGAYWRSWYDSPTFEDDLEHLYHQLEPLYLNLHAFVRRALHRRY
GDRYINLRGPIPAHLLGDMWAQSWDNIYDMVVPFPDKPNLDVTITMLQQGWNATHMFRVA
EEFFVSLGLSPMPPEFWAESMLEKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLF
TVHHEMGHVQYYLQYKDQPVSLRKGANPGFHEAIGDVLALSVSTPAHLYKIGLLDHVTND
TESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPV
TRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHQALCQEAGYQGALHQCDIYQSTKAG
AKLRKVLQAGSSRPWQEVLKEMVGSDALDAQPLLDYFQPLTQWLQEQNQKNSEVLGWPEY
QWRPPLPNNYPEGIDLVTDEAEARKFVEEYDRTSQVVWNEYAEANWNYNTNITRETSSIL
LQKNMQIANYTLQYGTQARRFDVSHFQNTTIKRILKKVQDLERAALPAQELEEYNKILLD
METTYSVATVCHTNGSCLQLEPDLTNVMATSRKYEELLWAWKGWRDKTGRTILQFYPKYV
EFINKAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGA
QHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSATLMDTTEAMLKQGWTPRRMFKEADD
FFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVA
HHEMGHIQYFMQYKDLPVALRDGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGDSFE
HNINFLMKMALEKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPR
TQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQVAGHTGPLHKCDIYQSKEAGQR
LAAAMKLGFSQPWPEAMRLITGQPNMSASAMLSYFKPLLDWLRAENELHGEKLGWPQYNW
TPNSARSEGPFPDSGRVSFLGLDLEPQQARVGQWLLLFLGIALLVATLGLSQRLFSIRRH
SLRQPHHGPQFGSEVELRHS
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggacctactccaccgccaaggtctgcctccccaacaagactgccacctgctgg
tccctggacccagaactcaccaacatcctggcttcctcgagaagctacgccatgctcctg
tttgcctgggagggctggcacaacgccgcgggaatcccgctgaaaccgctgtatgaggat
ttcactgccctcagcaatgaagcctccaagcaggatggcttttcagacacgggggcctac
tggcgctcctggtatgactcccccaccttcgaggatgatctggagcacctctaccatcag
ctggagcccctctacctgaacctccatgccttcgtccgccgcgcactgcatcgccgatac
ggggacagatacatcaacctcaggggacccatccctgctcatctgctgggagacatgtgg
gcccagagctgggacaacatctacgacatggtggtgcctttcccagacaagcccaacctt
gatgtcactattactatgctgcagcagggctggaatgccacacacatgttccgggtggca
gaggagttcttcgtctccctggggctctcccccatgcctccagagttctgggcagagtcg
atgctggagaagccggccgacgggcgggaggtggtgtgccatgcctcagcttgggatttc
tacaatcggaaagacttcaggatcaagcagtgcacgcgggtcacgatggaccagctcttc
actgtacaccatgagatgggccacgtgcagtactacctacagtacaaggaccagcccgtc
tccctgcgcaagggcgccaaccccggcttccatgaggccatcggggacgtgctggcgctc
tcggtctccactcctgcacatctgtacaaaatcggcctactggatcatgtcactaatgac
acggaaagtgacatcaattacttgctaaagatggcactggaaaaaattgccttcctgccc
tttggctacttggtggaccagtggcgctggggggtctttagcgggcgtacccccccttcc
cgctacaacttcgactggtggtaccttcgaaccaagtatcaggggatctgtcctcctgtc
acccgaaatgaaacccactttgatgctggagcaaagtttcatgtcccaaatgtgacacca
tacatcaggtactttgtgagttttgtcctgcagttccagttccatcaagccctgtgccag
gaggcaggctatcagggtgcactgcaccagtgtgacatctaccagtccaccaaagcaggg
gccaagctccggaaggtgctgcaggctggctcctccaggccctggcaggaagtgctgaag
gagatggtcggctcagatgccctggatgcccagccactgctcgactacttccagccactc
acccagtggctgcaggagcagaaccagaagaacagcgaggtcctgggctggccagagtac
cagtggcgcccaccgttgcccaacaactacccggagggcattgacctggtgaccgatgag
gctgaggccaggaagttcgtggaggaatatgaccgaacatcccaggtggtgtggaacgag
tacgccgaggccaactggaattacaacaccaacatcaccagagagaccagcagcattcta
ctgcagaagaacatgcagatagccaactacacgctgcagtacggcacccaggccaggagg
tttgatgtgagccacttccagaacaccactatcaagcggatcctcaagaaggttcaggac
ctagaacgggcagcactgcctgcccaggagctggaggagtacaacaagatcctgctggac
atggaaaccacctacagcgtggccactgtgtgccacacgaatggcagctgcctacagctc
gagccagatctgacgaacgtgatggccacatcccggaaatatgaagaactgttatgggcg
tggaagggctggcgagacaagacggggagaaccatcctccagttttacccgaaatacgtg
gaatttatcaacaaggcagcccggctcaacggctatgtagatgcaggggactcctggagg
tctatgtacgagacgccatccctggagcaagacctggagcggctcttccaggagctgcag
ccgctctacctgaacctgcatgcctatgtgcgccgggccctgcaccgccactacggggcc
cagcacatcaacctggagggccccatccctgctcacttgctggggaacatgtgggcacag
acctggtccaacatctatgacttggtggtgcccttcccttcagccaccttgatggacacc
acagaggccatgctaaagcagggctggacgcccaggaggatgtttaaggaggctgatgat
ttcttcacctccttggggctgctgcccgtgcctcctgagttctggaacaagtcgatgctg
gaaaagccaaccgacgggcgggaggtggtctgccatgcctcggcctgggacttctacaac
ggcaaggacttccggatcaagcagtgcaccactgtgaacttggaggacctggtggtggcc
caccacgaaatgggccacatccagtatttcatgcagtacaaagacttgcctgtggccttg
agggacggtgccaaccccggcttccatgaggccattggcgacgtgctagccctctcagta
tctacacccaagcacctgcacagtctcaacctgctgagcagcgagggcgacagctttgag
cacaacatcaactttctgatgaagatggcgctggaaaagatcgccttcatccccttcagc
tatcttgtggatcagtggcgctggagggtatttgatggaagcatcaccaaggagaactac
aaccaggagtggtggagcctcaggctgaagtaccagggcctctgtcccccggtgcccagg
actcaaggtgactttgatccaggggccaagttccacattccttctagtgtgccttacatc
aggtacttcgtcagcttcatcatccagttccagttccatgaggccctgtgccaggtggct
ggccacacgggccccctgcataagtgtgacatctaccagtccaaggaggccgggcagcgc
ctggcggccgccatgaagctgggtttcagtcagccgtggccggaagccatgcggctgatc
acgggccagcccaacatgagcgcctcggccatgctgagctacttcaagccactgctggac
tggctccgtgcggagaacgagctgcacggggagaagctgggctggccgcagtacaactgg
acacccaactccgctcgctcagaagggcccttcccagacagcggccgcgtcagcttcctg
ggcctggacctggagccacagcaggcccgcgtgggccagtggctgctgctcttcctgggc
atcgccctgctggtggccaccctgggcctcagccagcggctcttcagcatccgccgccac
agcctccgccagccccaccacgggccccagtttggctcggaggtggagctgagacactcc
tga

DBGET integrated database retrieval system