KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052142
Entry
101052142         CDS       T04350                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04015  Rap1 signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04068  FoxO signaling pathway
sbq04150  mTOR signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04510  Focal adhesion
sbq04650  Natural killer cell mediated cytotoxicity
sbq04720  Long-term potentiation
sbq04722  Neurotrophin signaling pathway
sbq04726  Serotonergic synapse
sbq04730  Long-term depression
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05034  Alcoholism
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101052142 (BRAF)
   04012 ErbB signaling pathway
    101052142 (BRAF)
   04015 Rap1 signaling pathway
    101052142 (BRAF)
   04068 FoxO signaling pathway
    101052142 (BRAF)
   04024 cAMP signaling pathway
    101052142 (BRAF)
   04150 mTOR signaling pathway
    101052142 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101052142 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101052142 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101052142 (BRAF)
   04062 Chemokine signaling pathway
    101052142 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101052142 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    101052142 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    101052142 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101052142 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    101052142 (BRAF)
   04720 Long-term potentiation
    101052142 (BRAF)
   04730 Long-term depression
    101052142 (BRAF)
   04722 Neurotrophin signaling pathway
    101052142 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052142 (BRAF)
   05205 Proteoglycans in cancer
    101052142 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101052142 (BRAF)
   05212 Pancreatic cancer
    101052142 (BRAF)
   05225 Hepatocellular carcinoma
    101052142 (BRAF)
   05226 Gastric cancer
    101052142 (BRAF)
   05214 Glioma
    101052142 (BRAF)
   05216 Thyroid cancer
    101052142 (BRAF)
   05221 Acute myeloid leukemia
    101052142 (BRAF)
   05220 Chronic myeloid leukemia
    101052142 (BRAF)
   05218 Melanoma
    101052142 (BRAF)
   05211 Renal cell carcinoma
    101052142 (BRAF)
   05219 Bladder cancer
    101052142 (BRAF)
   05215 Prostate cancer
    101052142 (BRAF)
   05213 Endometrial cancer
    101052142 (BRAF)
   05224 Breast cancer
    101052142 (BRAF)
   05223 Non-small cell lung cancer
    101052142 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101052142 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    101052142 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    101052142 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101052142 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101052142 (BRAF)
   05160 Hepatitis C
    101052142 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101052142 (BRAF)
   01522 Endocrine resistance
    101052142 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101052142 (BRAF)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101052142 (BRAF)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101052142 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 101052142
NCBI-ProteinID: XP_003929813
LinkDB
Position
Unknown
AA seq 764 aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTVTS
SSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEPSLAETALTSGSSPSAPPSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggcggcggcgcggagccgggccaggctctgttcaac
ggggacatggagcccgaggccggcgccggcgccgcggcctcttcggctgcggaccctgcc
attcctgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagag
gccctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcatat
gaagaatacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatct
ctggggaacggaactgatttttctgtttctagctctgcatcaatggacaccgttacatct
tcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccaca
gatgtggcacggagcaaccccaagtcaccacaaaaacctatcgttagagtattcctgccc
aacaaacagaggacagtggtacctgcaaggtgtggcgttacagtccgagacagtctaaag
aaagcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggagagaagaaaccaattggctgggacactgatatttcctggcttactggagaagaattg
catgtggaagtgttggagaatgttccacttacaacacacaactttgtacgaaaaacattt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaa
acgtgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccaccctataccacag
gaagagccttccttagcagagactgctcttacatctggatcatccccttccgcacccccc
tcagactctattgggccccaaattctcaccagtccatctccttcaaaatccattccaatt
ccacagcccttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccgg
tcctcatcagctcccaatgtgcatataaacacaatagaacctgtcaatattgatgacttg
attagagaccaaggatttcgtggtgatggaggatcaaccacaggtttgtctgccacacct
cctgcctcattacctggctcactcactaacgtgaaagccttacagaaatctccaggacct
cagcgagaaaggaagtcatcttcatcctccgaagataggaatcgaatgaaaacacttggt
agacgggactcaagtgatgattgggaaattcctgatgggcagattacagtgggacaaaga
attggatctggatcatttggaacagtctacaagggaaagtggcatggtgatgtggcagtc
aaaatgttgaatgtgacagcacccacacctcagcagttacaagccttcaaaaatgaagta
ggagtactcaggaaaacacgacacgtgaatatccttctcttcatgggctattccacaaag
ccacagctggctattgttacccagtggtgtgaaggctccagcttgtatcaccatctccat
atcattgagaccaaatttgagatgatcaaacttatagatattgcacgacagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatata
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtcatcagaatgcaagataaaaatccatacagctttcagtcagatgtatacgcattt
gggattgttctgtatgaattgatgactggacagttaccttattcaaacatcaacaacagg
gaccagataatttttatggtgggacgaggatacctatctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagat
gagagaccactctttccacaaattcttgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaggat
tttagtctatatgcttgtgcttctccaaaaacacccatccaggcagggggatatggtgcg
tttcctgtccactga

DBGET integrated database retrieval system