KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052217
Entry
101052217         CDS       T04350                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04062  Chemokine signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04670  Leukocyte transendothelial migration
sbq04810  Regulation of actin cytoskeleton
sbq04935  Growth hormone synthesis, secretion and action
sbq05100  Bacterial invasion of epithelial cells
sbq05135  Yersinia infection
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05205  Proteoglycans in cancer
sbq05222  Small cell lung cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101052217 (PTK2)
   04370 VEGF signaling pathway
    101052217 (PTK2)
   04151 PI3K-Akt signaling pathway
    101052217 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101052217 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101052217 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101052217 (PTK2)
   04062 Chemokine signaling pathway
    101052217 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101052217 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    101052217 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052217 (PTK2)
   05202 Transcriptional misregulation in cancer
    101052217 (PTK2)
   05205 Proteoglycans in cancer
    101052217 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101052217 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101052217 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101052217 (PTK2)
   05100 Bacterial invasion of epithelial cells
    101052217 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101052217 (PTK2)
   05163 Human cytomegalovirus infection
    101052217 (PTK2)
   05165 Human papillomavirus infection
    101052217 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101052217 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101052217 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101052217 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101052217 (PTK2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101052217 (PTK2)
Protein kinases [BR:sbq01001]
 Non-receptor tyrosine kinases
  FAK family
   101052217 (PTK2)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101052217 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_N_2 Focal_AT Kinase-like FERM_M
Other DBs
NCBI-GeneID: 101052217
NCBI-ProteinID: XP_010328277
LinkDB
Position
Unknown
AA seq 1051 aa
MLLELAGQEALKPAGAIYMERSGCSPFPVCWAKEYDRYLASSKIMAAAYLDPNLNHTPNS
STKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLDSVKVIRSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSGVSHCQHKVKKARRFLPLVFCSHDPPST
DEISGDETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQG
VYISPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIM
ELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDC
VKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHG
VKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTI
LEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQT
NHYQVSGYPGSHGITAMAGSIYPGQASLLDQADSWNHRPQEISMWQPNVEDSTALDLRGI
GQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQH
IYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPGDSYNEGVKPWRLQPQEISPPPTAN
LDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLP
ASTHREVGHNLSLAAFCDSTGWGHIQGCLWC
NT seq 3156 nt   +upstreamnt  +downstreamnt
atgttgttggaactggcaggccaagaggccctgaaaccagcaggtgccatctatatggag
agaagcggctgtagtccatttccagtgtgttgggctaaagagtatgacagatacttagca
tctagcaaaataatggcagctgcttatcttgaccccaacttgaatcacacaccaaattcg
agtactaagactcacctgggtactggtatggaacgttctcctggtgcgatggagcgagta
ttaaaggtctttcattattttgaaagcaatagtgagccaaccacctgggccagtattatc
aggcatggagatgctactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcatgtggcctgctatggattccgcctcagtcacctgcggtcagaggaggttcac
tggcttcacgtggatatgggcgtctccagtgtgagggagaagtatgagcttgctcaccca
ccagaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagataagccaaccttgaatttcttctatcaacaggtgaagagtgattatatg
ttagagatagctgatcaagtggaccaggaaattgctttgaagttgggttgtctagaaata
cggcgatcatactgggagatgcggggcaatgcactagaaaagaagtctaactatgaagta
ttagaaaaagatgttggtttaaagcgattttttcctaagagtttactggattctgtcaag
gtaattagatcaagctggattatttcagtggaactggcaatcggcccagaagaaggaatc
agttacctaacggacaagggctgcaatcccacacatcttgctgacttcaatcaagtacaa
accattcagtattcaaacagtgaagacaaggacagaaaaggaatgctacaactaaaaata
gcaggtgcacccgagcctctgacagtgacggcaccatccctaaccattgcagagaatatg
gctgacctgatagatgggtactgccgactggtgaatggagcctcgcagtcttttatcatc
agaccccagaaagaaggtgaacgggctttgccatcaataccaaagctggccaacagtgaa
aagcaaggcatgcggacacacgccgtctctgtgtcaggagtcagtcactgccaacataaa
gttaagaaagctaggcgctttctccctttggtcttctgttcccatgatcctccttctacg
gatgaaattagtggggacgaaacagatgattatgctgagattatagatgaagaagatact
tacaccatgccctcaaaaagctatggaatagatgaagccagagattatgagattcaaaga
gaaagaatagaacttggacgatgtattggagaaggccaatttggagatgtacatcaaggc
gtttatatcagtccagagaatccagctttggcagttgcaattaaaacatgtaaaaactgt
acttcggacagcgtgagagagaaatttcttcaagaagccttaacaatgcgtcaatttgac
caccctcatattgtgaagctaattggagtcatcacagagaatcctgtctggataatcatg
gagctatgcacacttggagagctgaggtcatttttgcaagtaaggaaatacagtttggat
ctagcatctttgatcctgtatgcctatcagcttagcacagctcttgcatatctagagagc
aaaagatttgtacacagggacattgctgctcggaatgttctagtgtcctcaaatgattgt
gtaaaattaggagactttggattatcccgatatatggaagatagtacttactacaaagct
tccaaaggaaaattgcctattaaatggatggctccagagtcaatcaattttcgacgtttt
acctcagctagtgacgtatggatgtttggtgtatgtatgtgggagatactgatgcatggt
gtgaagccttttcaaggagtgaagaacaatgatgtgatcggtcgaattgaaaatggggaa
agactaccaatgcctccaaattgtcctcctaccctctacagccttatgacgaaatgctgg
gcctatgaccccagcaggcggcccaggtttactgaacttaaagctcagctcagcacaatc
ctggaggaagagaaggctcagcaagaagaacgcatgaggatggagtccagaagacaggcc
acagtgtcctgggactccggagggtctgatgaagcgccgcccaagcccagcagaccaggt
tatcctagtccgagatccagcgaaggattttatcccagcccacagcacatggtgcaaacc
aatcattatcaggtctctggctaccctggttcgcatggaatcacagctatggctggcagc
atctatccaggtcaggcatctcttttggaccaagcagattcatggaatcatagacctcag
gagatatcaatgtggcagcccaatgtggaggactctacagcattggacctgcgagggatt
gggcaagtgttgccaacccacctgatggaagagcggctaatccgacagcaacaggaaatg
gaagaagatcagcgctggctggaaaaagaggaaagatttctgaaacctgatgtgagactc
tctcgaggcagcattgacagggaggatggaagtcttcagggtccgattggaaaccaacat
atatatcagcctgtgggtaaaccagatcctgcagctccaccaaagaaaccacctcgccct
ggagcccccggtcacctgggaagccttgccagcctcagcagccctggggacagctacaac
gagggtgtcaagccatggaggcttcagccccaggaaatcagcccccctcctactgccaac
ctggaccggtcaaatgataaggtgtatgagaatgtgacgggcctggtgaaagctgtcatc
gagatgtccagtaaaatccagccggccccaccagaggaatatgtccctatggtgaaggaa
gtcggcttggccctgaggacgttattggccactgtggatgagaccattcccctcctacca
gccagcacccaccgagaggtagggcacaatctttcccttgcagccttctgtgacagcact
ggttggggacacattcagggatgcctttggtgctaa

DBGET integrated database retrieval system