KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052249
Entry
101052249         CDS       T04350                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04218  Cellular senescence
sbq04370  VEGF signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101052249 (MAPKAPK2)
   04370 VEGF signaling pathway
    101052249 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101052249 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101052249 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101052249 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101052249 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101052249 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101052249 (MAPKAPK2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101052249 (MAPKAPK2)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   101052249 (MAPKAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like Choline_kinase
Other DBs
NCBI-GeneID: 101052249
NCBI-ProteinID: XP_010339317
LinkDB
Position
Unknown
AA seq 318 aa
MLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDR
GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKE
TTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISP
GMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMALIRTPF
VSSQQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPL
LLKRRKKARALEAAALAH
NT seq 957 nt   +upstreamnt  +downstreamnt
atgcttcaggactgccccaaggcccgcagggaggtggagctgcactggcgggcctcccag
tgcccgcacatcgtgaggatcgtggatgtctatgagaatctgtatgcagggaggaagtgc
ctgctgattgtcatggaatgtttggacggcggagaactctttagccgaatccaggaccga
ggagaccaggccttcacagaaagagaagcatccgaaatcatgaagagcattggtgaggcc
atccagtatctgcactcaatcaacattgcccatcgggatgtcaagcctgagaatctttta
tacacctccaaaaggcccaacgccatcctgaaactcacagactttggctttgccaaggaa
accaccagccacaactctttgaccactccttgttatacgccatactatgtggctccagaa
gtgctgggccccgagaagtatgacaagtcctgtgacatgtggtccctgggtgtcatcatg
tacatcctgctgtgtgggtatccccccttctactccaaccatggccttgccatctctcct
ggcatgaagactcgcatccgaatgggccagtatgaatttcccaacccagaatggtcagaa
gtatcagaggaagtgaagatgctcattcggaacctgctgaaaacagagcccacccagaga
atgaccatcaccgagtttatgaaccatccctggatcatggctttgattcggacccctttc
gtctcttctcagcaatcaacgaaggtccctcaaaccccactgcacaccagccgggtcctg
aaggaggacaaggagcggtgggaggatgtcaaggaggagatgaccagtgccttggccaca
atgcgcgttgactatgaacagatcaagataaaaaagattgaagatgcgtccaaccctctg
ctgctgaagaggcggaagaaagctcgggccctggaggccgcggccctggcccactga

DBGET integrated database retrieval system