KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052252
Entry
101052252         CDS       T04350                                 

Gene name
ACAA1
Definition
(RefSeq) 3-ketoacyl-CoA thiolase, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq00280  Valine, leucine and isoleucine degradation
sbq00592  alpha-Linolenic acid metabolism
sbq01040  Biosynthesis of unsaturated fatty acids
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
Module
sbq_M00087  beta-Oxidation
sbq_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101052252 (ACAA1)
   00592 alpha-Linolenic acid metabolism
    101052252 (ACAA1)
   01040 Biosynthesis of unsaturated fatty acids
    101052252 (ACAA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101052252 (ACAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101052252 (ACAA1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101052252 (ACAA1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     101052252 (ACAA1)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Other DBs
NCBI-GeneID: 101052252
NCBI-ProteinID: XP_003930949
UniProt: A0A2K6TRH9
LinkDB
Position
Unknown
AA seq 424 aa
MRRLQVVLGHLAGQPDPGWTLQAAPCSSGAPQASAADVVVVHGRRTAICRAGRGGFKDTT
PDELLSAVMTAVLQDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSSVN
RQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIP
MGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTMVHDDKGTKRSI
TVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPI
LGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLR
LPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE
YPGN
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcggaggctgcaggtagtgctgggccacctggctggccagcccgatcccggctggacg
ctgcaggcggcgccttgctcgagcggcgccccgcaggcctcggccgcggacgtggtggtg
gtgcacgggcggcgcaccgccatctgccgggcgggccgcggcggcttcaaggacaccacc
cccgacgagcttctctcggctgtcatgaccgcggttctccaggacgtgaatctgcgtccg
gaacagctgggggacatctgtgtcggaaatgtgctgcagcccggggccggggcaatcatg
gcccgaatcgcccagtttctgagtgacatcccagagactgtgcctctgtcctctgtcaat
agacagtgctcatcagggctacaggcagtggccagcatagctggtggcatcagaaatggg
tcttatgacattggcatggcctgtggggtggagtccatgtccctggctgacagagggaac
cctggaaatattacttcgcgcttgatggagaaggagaaggccagagattgcctgattcct
atgggaataacctcggagaatgtggctgagcggtttggcatttcacgggagaagcaggat
acttttgccctggcttcccagcagaaggcagcaagagcccagagcaagggctgtttccaa
gctgagattgtgcctgtgaccaccatggtccatgatgacaagggtaccaagaggagcatc
actgtgacccaggatgagggcatccgccccagcaccaccatggaggggctggccaaactg
aagcctgccttcaagaaggacggttctaccacagctggaaactctagccaggtgagtgat
ggggcagctgccatcctgctggcccggaggtccaaggcagaagagttgggccttcccatc
cttggggtcctgaggtcctatgcagtggttggggtcccacctgacatcatgggcatcgga
cctgcctatgccatcccggtagctttgcaaaaagcagggctgactgtgagtgacgtggac
atctttgagatcaacgaggcctttgcaagccaggctgcctactgtgtggagaagctacga
ctcccgcctgagaaggtgaaccctctggggggtgcagtggccttggggcacccactgggc
tgcactggggcacgacaggtcatcacgctgctcaacgagctgaagcgccgtgggaagagg
gcatatggagtagtgtccatgtgcatcgggactggaatgggagctgctgctgtctttgaa
taccctgggaactga

DBGET integrated database retrieval system