KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052399
Entry
101052399         CDS       T04350                                 

Gene name
RAPGEF1
Definition
(RefSeq) rap guanine nucleotide exchange factor 1 isoform X1
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04015  Rap1 signaling pathway
sbq04510  Focal adhesion
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101052399 (RAPGEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101052399 (RAPGEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101052399 (RAPGEF1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101052399 (RAPGEF1)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101052399 (RAPGEF1)
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 101052399
NCBI-ProteinID: XP_010339866
LinkDB
Position
Unknown
AA seq 1265 aa
MGNAIEKQKPLKRGHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVK
IPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSWLEEKEKEVVS
ALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQSDPRIQHSSALSSCYSRVYQSL
ANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPS
SPAGKPDGPAELPLTDREVEILNKTTGMSQSTELLPDATDEEVAPPKPPLPGIRVVDNSP
PPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQDFDIDCYAQRRLSGGSHSYG
GESPRLSPCSSIGKLSKSDEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQ
IPQQTAWSLSPLPESLGESGSPFLGHPFQLPLGNHPQPDGALAPGQQTDTPPALPEKKRR
SAASQTADSSGCRVSFERHPSQYDNISGEDLQSTAPVQPVTYAPFAAILPFQHGGSSAPV
EFVGDFTAPESTGDPEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQNEHIYQQK
NKLLMEVYGFSDSFTGADSVQELAPPPALPPKQRQLQASCAAASFSSVSYCVQQTKVAFT
PEDGSAAQGLSVSVSNSFLSRHGSLPVPSYKSVFRSYSQDFVPHHQASVPPFLPPTSSSS
PHFPPVHQSQSSDLAVPTIAGPPPSTVDGPLSASQESSFHGNTVCLPSETSFTDSSENAS
EEAGEGEYVNLYSSGQSSEELAPPRGDPPAGKDGHPRDPTAVGSVPGKDSRDGSERAPKS
PDALESAQSEEEVDELSLIDHSEIMSRLTLKQEGDDGPDVRGGSGDILLVHATETDRKDL
VLYCEAFLTTYRTFISPEELIKKLQYRYEKFSPFADTFKKRVSKNTFFVLVRVVDELCLV
ELTEEILKLLMELVFRLVCNGELSLARVLRKNILDKVDQKKLLRCATSGQPLAARGVAAR
PGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYW
VRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSE
GLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKR
WQQFNILDSMRRFQQAHYDIRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTD
REEKT
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgggcaatgctattgaaaaacagaagcccttgaaacgaggccatctgtacccctggaaa
caagactctcaacgttctcatctctcttccttcaccatgaagctgatggacaaattccac
tcacccaaaatcaagagaacaccatcgaagaagggaaaaccagctgaggtgtccgttaag
attccagagaagcctgtgaacaaagaggcaacagacagatttctaccagagggctaccct
ctccccttggatctggagcagcaggcagtagaatttatgtccaccagtgctgtggcttcc
aggtctcaaaggcagaagaacctgagctggctggaggagaaagagaaggaagttgtcagt
gccctgcgctactttaagaccattgtggacaaaatggcaattgataagaaggtactggag
atgcttccagggtcagccagcaaggtgctggaggccatcttacccctggtgcagagcgac
cctcgaattcagcacagctcagccctctcttcctgctatagccgagtgtaccaaagtctc
gccaacctcattcgctggtctgaccaagtgatgctggaaggtgtgaactcagaagacaag
gagatggtgacgactgtgaagggagtcatcaaggctgtactggacggagtgaaggagctg
gtcaggctcaccatcgagaagcagggacgtccgtctccgacgagccccgtgaagcccagt
tctcctgccggcaagcctgatggcccagcagagctccccctgacagaccgagaggtagag
atcctaaacaagacaaccggcatgtcgcagtcaacagagctcctcccagacgccacggat
gaagaggtcgcaccccccaagccccctctgcctggcattcgggtggttgataatagtcct
ccaccagcgttgccacccaagaaaagacagtcggcgccgtcccctacccgagtggctgtg
gtggcccccatgagccgagccaccagtggctccagtttgcctgttggaatcaataggcag
gattttgacattgactgttacgcacagaggcgactgtcaggaggcagccactcgtacggt
ggagagtcgccccgcctgtcaccctgcagcagcataggcaagctcagcaagtcggatgaa
cagctctcttctctggacagggacagtgggcagtgctcccggaacacaagctgtgaaaca
ctagaccactatgatcccgactatgaattcctccagcaagacctctctaacgcagaccag
atacctcagcagacggcctggagccttagcccgttgccagagtccttgggggagtctggg
tctccatttcttggccatcctttccagctgcctcttggcaaccatccccagccagacgga
gcactggccccagggcagcagacagacacgccgcctgctctccccgagaagaagcgcagg
agcgcagcctcccagacagcggacagctctggctgcagggtgtctttcgagcggcatccc
tcgcagtatgacaacatctctggggaggacctgcagagcacagccccagtccagcccgtc
acctatgcacccttcgctgctattctcccctttcagcatggaggttcctcagcccctgta
gaatttgtgggtgactttactgctcctgaatcaacgggtgatccagaaaaaccgcctcct
ctaccagagaagaaaaacaaacacatgctggcctacatgcagctgctggaggactactca
gagccgcagccctccatgttctaccagacgccgcagaacgagcacatctaccagcagaag
aacaagctcctcatggaggtgtatggcttcagcgactccttcactggggcggactctgtg
caggagctggccccaccgcctgccctcccccccaagcagcggcagctgcaggcctcctgt
gctgctgcttccttctcctctgtctcctactgtgtccagcaaactaaagtggccttcacc
cccgaggacggcagtgccgctcagggcctcagtgtgtccgtctctaactcctttctcagc
cggcatggcagcttgcctgtgccctcgtataagtctgtgtttaggtcctactcccaggat
ttcgtgcctcaccaccaagcttccgttccgcctttccttccacctacctcctcttcctct
ccacatttcccacctgtccaccagtcccagagctctgacttagccgtgccaaccatagcc
ggtccacctcccagcaccgtggacgggcctctctcggcttctcaggagagcagctttcat
gggaatactgtctgccttccttccgaaacctctttcactgactcgagtgaaaacgccagt
gaggaagctggtgagggtgaatatgtcaatctgtattcctctggccagagcagcgaggag
ctggctccccctcgaggagatccaccggctgggaaagatggacatcccagagatcccacg
gcggtcggcagcgtccctgggaaggatagcagagacggcagtgagagggccccaaagtca
ccagatgctctggagtccgctcagtcagaggaggaagtggatgagctgtccctcatcgac
cacagtgaaattatgtccaggctgacgctcaagcaggagggtgatgacgggccagacgtc
cgcgggggatctggggacatcttattggtccatgctactgaaactgacaggaaagatttg
gtgttgtactgcgaggccttcctgaccacctacaggaccttcatctccccagaggagctc
atcaagaagctgcagtacagatacgagaaattctctccctttgctgacacattcaagaag
cgcgttagcaagaacacgttcttcgtgctggtgcgggtggtggatgagctctgcctggtg
gagttgacagaagagatcctgaagctgctgatggaactggtcttccgcctggtgtgcaat
ggggagctgagcctggcccgcgtgctccggaagaacatcctggacaaggtggaccagaag
aagctgctcaggtgtgccacctccggccagcccctggcggcccggggagtagcagccagg
ccggggaccttgcatgactttcatagccatgagatagcagagcagctgacactgctggat
gccgagctcttctataaaatagagattcctgaggttttgctttgggcaaaagagcagaat
gaggagaagagccccaacttgacccagttcacggagcacttcaacaacatgtcctactgg
gtccggtcaataatcatgttacaggaaaaggcccaggacagggaacggctgctcttgaag
ttcatcaagatcatgaagcacttgcggaagctgaataacttcaactcctacttggccatc
ctctccgccctggactcagcgcccatccgcaggctggaatggcagaagcagacttcagaa
ggcctggctgagtactgcacgctgatcgacagctcgtcctccttccgagcctaccgggcc
gccctctcggaggtggagcctccgtgcatcccgtacctggggctgatcctacaggacctg
accttcgtccacctgggaaaccccgactacatcgacgggaaagtgaacttctccaagcgg
tggcagcagttcaacatccttgacagcatgcggcgcttccagcaggcgcactatgacatc
cggaggaatgacgacatcatcaacttcttcaatgacttcagtgaccacctggctgaggag
gccctatgggaactctctctgaaaattaaacccaggaacataacaaggagaaaaacagac
cgggaagaaaagacctag

DBGET integrated database retrieval system