KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052478
Entry
101052478         CDS       T04350                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04630  JAK-STAT signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05160  Hepatitis C
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05226  Gastric cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101052478 (EGF)
   04012 ErbB signaling pathway
    101052478 (EGF)
   04014 Ras signaling pathway
    101052478 (EGF)
   04015 Rap1 signaling pathway
    101052478 (EGF)
   04630 JAK-STAT signaling pathway
    101052478 (EGF)
   04066 HIF-1 signaling pathway
    101052478 (EGF)
   04068 FoxO signaling pathway
    101052478 (EGF)
   04020 Calcium signaling pathway
    101052478 (EGF)
   04072 Phospholipase D signaling pathway
    101052478 (EGF)
   04151 PI3K-Akt signaling pathway
    101052478 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101052478 (EGF)
   04540 Gap junction
    101052478 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101052478 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052478 (EGF)
   05231 Choline metabolism in cancer
    101052478 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101052478 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101052478 (EGF)
   05212 Pancreatic cancer
    101052478 (EGF)
   05226 Gastric cancer
    101052478 (EGF)
   05214 Glioma
    101052478 (EGF)
   05218 Melanoma
    101052478 (EGF)
   05219 Bladder cancer
    101052478 (EGF)
   05215 Prostate cancer
    101052478 (EGF)
   05213 Endometrial cancer
    101052478 (EGF)
   05224 Breast cancer
    101052478 (EGF)
   05223 Non-small cell lung cancer
    101052478 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101052478 (EGF)
   05165 Human papillomavirus infection
    101052478 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101052478 (EGF)
Cytokines and growth factors [BR:sbq04052]
 Growth factors
  Growth factors (RTK binding)
   101052478 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA EGF cEGF DUF5050 EGF_3
Other DBs
NCBI-GeneID: 101052478
NCBI-ProteinID: XP_010338453
LinkDB
Position
Unknown
AA seq 1189 aa
MLLTLIILLPVVLKFSFVSLSAPQHWSCSEGTPAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVANAGVSVIMDFHYSEKRIYWVDLERQLLQRVFLNGSRQERVYNIEKNVSG
MAINWINEEVIWSNQQEGTITVTDMKGNNSHVLFSALKDPANIAVDPVERFLFWSSEVAG
SLHRADLDGVEVKALLETSEKITAVSLDVLDKRLFWIQYNNEGSNSLICSCDYDGGSVQM
SKHHTEHNLFAMSLFGDHIFYSTWKTKTIWIANKHTGKDMVKINLNPSFVPPSELKVVHP
LTQPRAEDDAQKPEQKLCKSRKGNCSSIVCGQDPQSHLCTCTEGYALSRDRKYCEGNDWK
YCEGNDRKYCEDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCASN
VSECSHDCVLTSEGPLCFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECDCF
PGYDLQLDKKSCAASGPQPFLLFANSQDIRQMHFDGTDYGTLLIQQMGMVYALDHDPVEN
KIYFAHTALKWIERANMDGSQRERLIEETVDVPEGLAVDWIGRRFYWTDRGTSLIGRSDL
DGKHPEIIIKENISQPRGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVLASSDLIWP
SGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFQDYVWFSDWAM
PSVIRVNKRTGKDRVRLRGSMLKPSSLVVIHPLAKPGADPCLYQNGGCEHICKERLGTAW
CSCREGFMKAPDGKMCLALDGHQPLAGGEADLKNQVTPPDTLSKTTVSEDNITESQHMLV
AEILVSGLCSDIDECEMGVPVCPPASSKCINTEGGYVCQCSEGYRGDGIHCLDIDECQLG
VHGCGENADCTNTEGGYACTCAGRLSEPGLICPDSTSPSHLREDDHRYSVRNSDSGCPPS
HSGYCLHDGVCMYIETVDKYACNCVVGYLGERCQYQDLKWWELRHAGHGQQRKVTVVAVC
VVALAVLLLLSLWGAHYYRTQKLLSKNPENPHEESSRDVSSRRPVDSEAGMSSCPQPWFV
SLKEHQDLRIGSQAEAGEDGHAADAGSVQTTSWSQEPHLRGMGTEQGCWIPVSSDEGSCP
QAMERSFHMPSPGTQPLDGVGEKPHSLLSANPLWQQRALDPSHHMELTE
NT seq 3570 nt   +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagttttaaaatttagttttgtcagtctg
tctgcaccacagcactggagctgttctgaaggtactcccgcaggaaatgggaattctact
tgcgtgggtcctgcacccttcttaattttctcccacggaaatagtatctttaggattgac
acagaaggaaccaattatgagcaattggtggcgaatgctggtgtctcagtgatcatggat
tttcattacagtgagaaaagaatctattgggtggatttagaaagacaacttttgcaaaga
gttttcctgaatgggtcaaggcaagagagagtatataatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaaccatt
acagtaacagatatgaaaggaaataattcccacgttcttttcagtgctttaaaagatcct
gcaaatatagcagttgatccagtagaaaggtttctgttttggtcttcagaggtggctggc
agccttcacagagcagatcttgatggtgtggaagtgaaggctctgttagagacatcagag
aaaataacagctgtgtcactggatgtgcttgataagcgattgttttggattcagtacaac
aatgaaggaagcaattctcttatttgttcctgtgattatgatggaggttctgtgcagatg
agtaaacatcacacagagcacaatttgtttgcaatgtccctttttggtgaccatatcttc
tattcaacatggaaaacaaagacaatttggatagccaacaaacacactggaaaggatatg
gttaaaattaacctcaatccatcatttgtaccacccagcgaactgaaagtagtgcatcca
ctcacacagcccagggcagaagatgatgctcagaagcctgagcagaaactttgcaaatcg
aggaaaggaaactgcagcagcattgtgtgtgggcaagacccccagtcccacttgtgcacg
tgtacagagggatacgccttaagccgagaccggaagtactgtgaaggtaatgactggaag
tactgtgaaggtaatgaccggaagtactgtgaagatgttaatgaatgtgccttttggaat
catggctgtactcttgggtgtaaaaacacccctggatcctattactgcacatgccctgta
ggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcctgtgcaagcaat
gtgtccgaatgcagccatgactgtgttctgacatcagaaggtcctttatgtttctgtcct
gaaggctcagtgcttgagagagatgggaaaacatgtagcggttgttcctcacctgataat
ggtggatgtagccagctctgcattcctctaagcccagtatcctgggaatgtgattgcttt
cctggatatgacctacaactggacaaaaaaagctgtgcagcttcaggaccacaaccattt
ttgctgtttgccaattctcaagatattcgacaaatgcattttgatggaacagactatgga
actctgctcatccagcagatgggaatggtttatgccctggatcacgaccctgtggaaaat
aagatatactttgcccatacagccctgaagtggatagagagagctaacatggatggttcc
cagcgagaaaggctcattgaggaaacagtagatgtcccagaaggtcttgctgtggactgg
attggccgtagattctattggacagacagagggacatctctgattggaaggagtgattta
gatggaaaacatcccgaaataataattaaggagaacatctctcaaccacgaggaattgct
gttcatccaatggccaagagattattctggactgatacagggattaatccacgaattgaa
agttcttccctccaaggccttggccgactggttttagccagctctgatctcatctggccc
agtggaataacgatagacttcttaactgacaagttgtactggtgcgatgccaagcagtct
gtgattgaaatggccaatctggatggttcaaaacgccgaagacttacccagaacgatgta
ggtcacccatttgctgtagccgtgtttcaggattatgtgtggttctcagactgggctatg
ccatcagtaataagagtaaacaagaggactggtaaagatagagtacgtctccgaggcagc
atgttgaagccctcatcactggttgtgattcatccattggcaaaaccaggagcagatccc
tgcttatatcaaaacggaggctgtgaacatatttgcaaagagaggcttggaactgcttgg
tgttcgtgtcgtgaaggttttatgaaagccccagatgggaaaatgtgtctggctctggat
ggtcatcagccgttggcaggtggtgaagctgatctaaagaaccaagtaacaccaccggac
accttatctaagaccacagtgtcagaagataacatcacagagtctcaacacatgctagtg
gctgaaatcttggtgtcaggactctgttctgatatagatgaatgtgagatgggtgtccca
gtgtgcccccctgcctcctccaagtgcatcaacaccgaaggtggctatgtctgccagtgc
tcagaaggctaccgaggagatgggattcactgtctcgatattgatgaatgccaactgggg
gtgcacggctgtggagagaatgccgactgcacaaatacagagggaggctacgcctgcacg
tgtgctggacgcctgtctgaaccaggactgatttgccctgactctacttcaccctctcac
ctcagggaagatgaccaccgctattccgtaagaaatagtgactctggctgtcccccatcc
cacagtgggtactgcctccacgatggtgtgtgcatgtatatcgaaacagtggacaagtac
gcgtgcaactgtgttgttggctacctcggggagcgatgtcagtaccaagacctgaagtgg
tgggaactgcgccacgctggccacgggcagcagcggaaggtcaccgtggtggctgtctgt
gtggtggcgcttgccgtgctgctcctcctgagcctgtggggggcccactactacaggact
cagaagctgctatcgaaaaatccagagaatcctcatgaggagtcaagcagagatgtgagc
agccgcaggcctgtggacagtgaggctgggatgtcctcttgccctcaaccttggtttgtg
agtctaaaggaacaccaagacctcaggattgggagtcaagcggaggctggtgaggatggt
cacgcagcagatgctgggtcagtgcaaacaacttcatggagtcaggagccccatttacgt
ggaatgggcaccgagcaaggctgctggattccagtatccagtgatgagggttcctgtccc
caggcaatggagcgaagctttcatatgccctcccctggaacacagccccttgatggggtt
ggcgagaagccccattctctcctgtcagctaacccattatggcaacaaagggccctggac
ccatcacaccacatggagctgactgagtga

DBGET integrated database retrieval system