KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052630
Entry
101052630         CDS       T04350                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains protein 1 isoform X2
  KO
K14365  four and a half LIM domains protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101052630 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101052630 (FHL1)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 LIM domain-containing proteins
  FHL family proteins
   101052630 (FHL1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 101052630
NCBI-ProteinID: XP_003940789
UniProt: A0A2K6THQ5
LinkDB
Position
Unknown
AA seq 296 aa
MASHRHSGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPRCKGC
FKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHEEQVYCPDCAKKL
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcttcccatagacactcaggtccctccagctataaggtgggcaccatggcggagaag
tttgactgccactactgcagggaccccttgcaggggaagaagtatgtgcaaaaggatggc
caccactgctgcctgaagtgctttgacaagttctgtgccaacacctgcgtggaatgccgc
aagcccatcggtgcggactccaaggaggtgcactataagaaccgcttctggcacgacacc
tgcttccgctgtgccaagtgccttcaccccttggccaatgagacctttgtggccaaggac
aacaagatcctgtgcaacaagtgcaccacccgggaggactcccccaggtgcaaggggtgc
ttcaaggccattgtggcaggagatcaaaacgtggagtacaaggggaccgtctggcacaaa
gactgcttcacctgcagtaactgcaagcaagtcatcgggactggaagcttcttccctaaa
ggggaggacttctactgcgtgacttgccatgagaccaagtttgccaagcattgcgtgaag
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgat
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggtttggtaaaggctccagtgtggtggcctatgaaggacaatcc
tggcacgactactgcttccactgcaaaaaatgctccgtgaatctggccaacaagcgcttt
gttttccacgaggagcaagtgtattgtcccgactgtgccaaaaagctgtaa

DBGET integrated database retrieval system