KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052794
Entry
101052794         CDS       T04350                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response protein MyD88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05134  Legionellosis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05144  Malaria
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101052794 (MYD88)
   04064 NF-kappa B signaling pathway
    101052794 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101052794 (MYD88)
   04621 NOD-like receptor signaling pathway
    101052794 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101052794 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101052794 (MYD88)
   05135 Yersinia infection
    101052794 (MYD88)
   05133 Pertussis
    101052794 (MYD88)
   05134 Legionellosis
    101052794 (MYD88)
   05152 Tuberculosis
    101052794 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101052794 (MYD88)
   05161 Hepatitis B
    101052794 (MYD88)
   05171 Coronavirus disease - COVID-19
    101052794 (MYD88)
   05164 Influenza A
    101052794 (MYD88)
   05162 Measles
    101052794 (MYD88)
   05168 Herpes simplex virus 1 infection
    101052794 (MYD88)
   05169 Epstein-Barr virus infection
    101052794 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    101052794 (MYD88)
   05145 Toxoplasmosis
    101052794 (MYD88)
   05140 Leishmaniasis
    101052794 (MYD88)
   05142 Chagas disease
    101052794 (MYD88)
   05143 African trypanosomiasis
    101052794 (MYD88)
SSDB
Motif
Pfam: TIR Death TIR_2
Other DBs
NCBI-GeneID: 101052794
NCBI-ProteinID: XP_003930951
LinkDB
Position
Unknown
AA seq 296 aa
MAAEGPGAGSVTPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTVLAEEMDFEYLE
IRQLESHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ
QQEEAEKPLQVASVDSSVPRTAELAGITTLDDPLGQMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMNKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggctgcagaaggtcccggcgcggggtctgtgaccccggtctcctccacatcctccctg
cccctggctgctctcaacatgcgagtgcggcgccgcctgtcgctgttcttgaacgtgcgg
acgcaggtggcggccgactggactgtgctggcggaggagatggactttgagtacttggag
atccggcagctggagtcgcacgccgaccccacgggcaggctgctggacgcctggcaggga
cgccccggtgcctcggtaggccgactgctggagctgctcaccaagctgggccgcgacgat
gtgctgctggagctgggacccagcattgaggaggattgccagaagtatatcttgaagcag
cagcaggaggaggctgagaagcccttacaggtggcctctgtcgacagcagtgtcccacgg
acagcagagctggcaggcatcaccacacttgacgaccccctggggcaaatgcctgagcgt
ttcgatgccttcatctgctattgccccagcgacatccagtttgtgcaggagatgatccgg
caactggagcagacaaactatcgactgaagttatgtgtgtctgaccgcgatgtcctgcct
ggcacctgtgtctggtctattgctagtgagctcatcgagaaaaggtgccgccggatggtg
gttgttgtctctgatgattacctgcagagcaaggaatgtgacttccagaccaaatttgca
ctcagcctctctccaggtgcccatcagaaacggctgatccccatcaagtacaaggcaatg
aacaaagagttccccagcatcctgaggttcatcactgtctgcgactacaccaatccctgc
accaaatcttggttctggactcgccttgccaaggccctgtccctgccctga

DBGET integrated database retrieval system