KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052988
Entry
101052988         CDS       T04350                                 

Gene name
EDN1
Definition
(RefSeq) endothelin-1 isoform X2
  KO
K16366  endothelin-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04024  cAMP signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04080  Neuroactive ligand-receptor interaction
sbq04270  Vascular smooth muscle contraction
sbq04668  TNF signaling pathway
sbq04916  Melanogenesis
sbq04924  Renin secretion
sbq04926  Relaxin signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05200  Pathways in cancer
sbq05410  Hypertrophic cardiomyopathy
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101052988 (EDN1)
   04066 HIF-1 signaling pathway
    101052988 (EDN1)
   04024 cAMP signaling pathway
    101052988 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101052988 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101052988 (EDN1)
   04916 Melanogenesis
    101052988 (EDN1)
   04924 Renin secretion
    101052988 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101052988 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052988 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101052988 (EDN1)
   05410 Hypertrophic cardiomyopathy
    101052988 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101052988 (EDN1)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 101052988
NCBI-ProteinID: XP_003927389
UniProt: A0A2K6SN16
LinkDB
Position
Unknown
AA seq 212 aa
MDYLPMIFFLLLVAFQGAPETAVLGTELSTVGENSGEKSTPSPPLRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVAPYGLGSPRAKRALENLLLTKAAAHKNRCQCAIQKDKKCW
NFCQAGKELRTLDSMQIAWNTHKKGKDCSKLGKKCVPQQLVRGRRIRRNSDEHLRQTRSE
TISNKVKQSSHDPKMKTKPSREHSVTHNRAHW
NT seq 639 nt   +upstreamnt  +downstreamnt
atggattatttgcccatgattttctttctgctgttggtggctttccaaggagctccagaa
acagcggtcttgggcactgagctcagcacagtgggtgagaacagcggggaaaaatccact
cctagcccacccttgcggctccgccggtccaagcgctgctcctgctcctccctgatggat
aaagagtgtgtctacttttgccacctggacatcatctgggtcaacactcccgagcacgtt
gctccatatggacttggaagccctagggccaagcgagccttggagaatttacttctcaca
aaggcagcagcccacaagaatagatgccaatgtgcaatccaaaaagacaagaagtgctgg
aatttttgccaagcaggaaaagaactcaggaccctagacagtatgcagatagcctggaat
acccataagaaaggaaaagactgttccaagcttgggaaaaagtgtgttcctcagcagtta
gtgagaggaagaagaatcagaagaaattcagatgaacacctaagacaaaccaggtcagag
accatcagcaacaaggtcaaacaatcttctcatgatcccaagatgaaaaccaagccctcc
agggagcacagcgtaacccacaaccgagcacattggtga

DBGET integrated database retrieval system