KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053050Help
Entry
101053050         CDS       T04350                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00250  Alanine, aspartate and glutamate metabolism
sbq00410  beta-Alanine metabolism
sbq00430  Taurine and hypotaurine metabolism
sbq00650  Butanoate metabolism
sbq01100  Metabolic pathways
sbq04727  GABAergic synapse
sbq04940  Type I diabetes mellitus
Module
sbq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101053050 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101053050 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101053050 (GAD1)
   00430 Taurine and hypotaurine metabolism
    101053050 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    101053050 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    101053050 (GAD1)
Enzymes [BR:sbq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101053050 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 101053050
NCBI-ProteinID: XP_010350558
UniProt: A0A2K6TCT9
LinkDB All DBs
Position
Unknown
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccatcttcttccgcaacctcctcgaacgcgggagcggaccccaat
accactaacctgcgccccacaacgtacgatacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agtcgccttgtgagcgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagcgaccgggatggccgcttccggcgcacggagaccgacttctccaacctgtttgct
cgagatctgcttccggctaagaacggcgaggagcaaaccgtgcagttcctcctggaagtg
gtggacatactccttaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagttgctggaaggcatggagggcttcaacttggagctctctgac
caccccgagtccctggagcagatcctggttgactgcagagacaccttgaagtatggggtt
cgcacaggtcatcctcgatttttcaatcagctctccactggattggatatcattggtcta
gccggagaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtgtttgtcctcatggaacaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggcgccatatccaacatgtacagcatc
atggctgctcgctacaagtactttccggaagttaagacaaagggcatggcggctgtgccc
aaactggtcctcttcacctcagaacacagtcactattccataaagaaagctggggctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgattttgaggcaaaaattcttgaagccaaacagaagggatatgttcccttttat
gtcaatgcaactgctggcacgactgtttacggagcttttgatccaatacaagagattgca
gatatatgtgagaaatataacctttggctgcatgtcgatgctgcctggggaggtgggctg
ctcatgtccaggaagcaccgccataaactcaacggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggtgtgctgttgcagtgctctgccattctcgtcaaggag
aagggtatactccaaggatgcaaccagatgtgtgcaggatacctcttccagccagacaag
cagtatgatgtctcctacgacaccggggacaaagcaattcagtgcggccgccacgtggat
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaaccagatc
aacaaatgcctggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggttttcgatggcgagcctgagcacacaaacgtctgtttttggtatattccgcaa
agcctcaggggtgtgccagacagccctgaacgacgggaaaagctgcacaaggtggctcca
aaaatcaaagccctgatgatggagtcgggcacgaccatggttggctaccagccccagggg
gacaaggccaacttcttccggatggtcatctccaatccagccgccacccagtctgacatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system