KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053072Help
Entry
101053072         CDS       T04350                                 

Gene name
SUV420H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1 isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101053072 (SUV420H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101053072 (SUV420H1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101053072 (SUV420H1)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101053072 (SUV420H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 101053072
NCBI-ProteinID: XP_003941228
UniProt: A0A2K6SAU3
LinkDB All DBs
Position
Unknown
AA seq 882 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNDHQQNQSKLLHTGKDTLKAGKNAVERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKPDSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTRQSLSRIPA
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPAQAAVASGCLTRHAAREHRQNPVRGAHLQGESSPCTYITRR
SVRTRTNLKEASDIKLEPNTLDGYKSSVTEPCPDSGDQPAPVVQEEELAHETAQNGEAKC
HKSDTGMSKKKSRQGKLVKQFAKIEESTPEHDSPGKDDTVPDLMGPHSDQGEHSGTVGVP
VSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRR
RHDSSSKTNDQENDGMNSSKISIKLSKDHDNDNNLYVAKLNNGFNSGSGSSSTKLKIQLK
RDEESRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTDDSSPSEGGEDDDYDD
DFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcaacagaatcaatcaaaattactgcacacggggaaggacaccctg
aaggctggcaaaaatgcagtcgagaggaggtcgagcagatgtaatggtaactcgggattt
gaaggacagagtcgttatgtaccatcttctggaatgtccgccaaggaactctgtgaaaat
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaacctgacagtttttct
cacaacaaccctgtgagatttcggcctattaaaggaaggcaagaagaactaaaggaagta
attgaacgttttaagaaagatgaacacttagagaaagccttcaaatgtttgacttcaggc
gaatgggcacggcactatttcctcaacaagaataaaatgcaggagaaattattcaaagaa
catgtatttatttatttgcgaatgtttgcaactgacagtggatttgaaatattgccatgc
aatagatattcatcagaacaaaatggagccaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcaactctggctgggtcctgctgcgtttataaaccatgattgcagacctaattgtaag
tttgtgtcaactggtcgagatacagcatgtgtgaaggctctgagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttctttggagaaaataatgagttctgcgag
tgttacacttgcgaaaggcggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctaaccgaaaatcttcagttggt
gtaaaaaagaatagcaagagcagaacgttaacgaggcaatctttgtcaagaattccagct
tcttccaactctacctcatctaagctaactcatataaataattccagggtaccaaagaaa
ctgaaaaagcctgcaaagcctttactttcaaagataaaattgagaaatcattgcaagcgg
ctggagcaaaagaatgcttcaagaaaactcgaaatgggaaacttagtactgaaagaacct
aaagtcgttctatataaaaatttgcccattaaaaaagataaggagccagagggaccagcc
caagctgcagtcgccagtgggtgcttgactagacacgcggcaagagaacacagacagaat
cctgtgagaggtgctcatctgcagggggagagctcaccctgtacctacataacccggcgg
tcggtgaggacaagaacaaatctgaaggaggcctctgacatcaagctcgaaccaaacacg
ctggatggctataaaagcagcgtgacggaaccttgccctgacagtggtgaccagccagct
cccgtggtgcaggaggaagaactggctcatgagactgcacaaaacggggaggcaaagtgt
cataagagtgacacaggcatgtccaagaagaagtcacgacaaggaaaacttgtgaaacag
tttgcaaaaatagaggaatctactccggagcatgattctcctggaaaagacgacacggtg
ccagatttgatgggaccccattctgaccagggcgagcacagtggcactgtgggcgtgcct
gtgagctacacagactgtgctccttcacccgtcggttgttcggttgtgacgtcagatagc
ttcaaaacaaaagacagctttagaactgcaaaaagtaaaaagaagaggcgaatcacaagg
tatgacgcacagttaatcctagaaaataactcggggattcccaaattgactcttcgtagg
cgtcatgatagcagcagcaagacaaatgaccaagagaatgatggaatgaattcttcaaaa
ataagcatcaagttaagtaaagaccatgacaacgataacaatctctatgtagcaaagctt
aataatggatttaactcaggatcaggcagtagttctacaaaactaaaaatccagctgaaa
cgagatgaggagagtaggggatcttacacagaggggcttcatgaaaatggggtgtgttgc
agcgatcctctttctctcctggagtctcgaatggaggtggacgactatagtcagtatgag
gaagaaagtacagatgactcttccccttctgagggcggcgaggacgatgactatgatgat
gactttgaagacgattttattcctcttcctccagccaagcgattgaggctaatcgttggg
aaagactctatagatattgacatttcttcaaggagaagggaagatcagtctttaaggctt
aatgcataa

DBGET integrated database retrieval system