KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053087
Entry
101053087         CDS       T04350                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00230  Purine metabolism
sbq01100  Metabolic pathways
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101053087 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101053087 (FHIT)
   05223 Non-small cell lung cancer
    101053087 (FHIT)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     101053087 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 101053087
NCBI-ProteinID: XP_010329236
UniProt: A0A2K6TUV1
LinkDB
Position
Unknown
AA seq 149 aa
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLRPDEVADLFQ
ATQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYDELQKH
DKEEEDSPASWRSEEEMAAEAAALRVYFQ
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtcattcagattcggccaacatctcatcaagccttctgtggtgtttctcaagacggaa
ctgtccttcgctcttgttaataggaaacctgtggtaccaggacatgtcctcgtgtgtccg
ctgcggccagtggagcgcttccgcgacctgcgtcctgatgaagtggctgatttgtttcag
gcgacccagagagttggaacagtggtggagaaacatttccacgggacttctctcacattt
tccatgcaggatggccccgaagccggacagactgtgaagcacgttcatgtccacgttctt
cccaggaaggctggagactttcacaggaatgacagcatctatgatgagctccagaaacac
gacaaggaagaggaggactccccggcctcttggagatcagaggaggaaatggcagcagaa
gctgcagctctgcgggtctactttcagtga

DBGET integrated database retrieval system