KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053144
Entry
101053144         CDS       T04350                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X2
  KO
K08528  retinoic acid receptor beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05200  Pathways in cancer
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101053144 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    101053144 (RARB)
   05222 Small cell lung cancer
    101053144 (RARB)
   05223 Non-small cell lung cancer
    101053144 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101053144 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101053144 (RARB)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    101053144 (RARB)
Nuclear receptors [BR:sbq03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   101053144 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 101053144
NCBI-ProteinID: XP_003936090
UniProt: A0A2K6UBP1
LinkDB
Position
Unknown
AA seq 448 aa
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatcgattgaaacacagagcaccagc
tctgaggaactcgtcccaagccctccatctccacttcctccccctcgagtgtacaaaccc
tgcttcgtctgccaggacaaatcatcagggtaccactatggtgtcagtgcctgtgaggga
tgtaagggctttttccgcagaagtattcagaagaacatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaagaagaag
gagacttcgaagcaagaatgcacagagagctatgaaatgacagctgagctggacgacctc
acagagaagatccgaaaagctcaccaagaaactttcccttcgctctgccagctgggtaaa
tacactacgaattccagtgctgaccatcgagtccggctggacctgggcctctgggacaaa
ttcagtgaactggccaccaagtgtattatcaagatcgtggagtttgctaaacgcctcccg
ggcttcaccagcttgaccatcgcagaccagatcaccctgctgaaggccgcctgcctggac
atcctgattcttagaatttgcaccaggtataccccagaacaagacaccatgactttttca
gacggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgctatctgcttaatctgtggagaccgccaggaccttgaggaaccgacaaaa
gtagataagctacaagaaccattgctggaagcactaaaaatttatatcagaaaaagacga
cccagcaagcctcacatgtttccaaagatcttaatgaaaatcacagatctccgcagcatc
agtgctaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggatcaatgcca
cctctcattcaggaaatgctggagaattctgaaggacatgaacccttgactccaagttca
agtggaaacacagcagagcacagtcctagcatctcacccagctcagtggaaaacagcggg
gtcagtcagtcaccactggtgcaataa

DBGET integrated database retrieval system