KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053270
Entry
101053270         CDS       T04350                                 

Gene name
FRAT1
Definition
(RefSeq) proto-oncogene FRAT1
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04310  Wnt signaling pathway
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05200  Pathways in cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101053270 (FRAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101053270 (FRAT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101053270 (FRAT1)
   05226 Gastric cancer
    101053270 (FRAT1)
   05224 Breast cancer
    101053270 (FRAT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101053270 (FRAT1)
   05022 Pathways of neurodegeneration - multiple diseases
    101053270 (FRAT1)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 101053270
NCBI-ProteinID: XP_010331680
LinkDB
Position
Unknown
AA seq 164 aa
GDRGRVRGRAAPYCVAELAAGPSALSPLPPQADLDGPRGAGKQGVPQPLSGPCRRGWLRG
AAASRRLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRP
LLGPLSAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVPVPGS
NT seq 495 nt   +upstreamnt  +downstreamnt
ggggaccgcggccgcgtgcggggccgcgctgcgccctactgcgtggcagagctcgccgca
ggccccagcgcgctgtccccactgccccctcaggccgaccttgatgggcctcggggggct
ggcaagcagggcgtcccgcagccgctgtcgggtccgtgccggcgaggatggctccggggc
gccgccgcctcccgccgcctgcagcagcgacgcggatcccaacccgaaacccgcacaggc
gacgacgacccgcaccggctcctgcagcagctagtgctctctggaaacctcatcaaggag
gccgtgcggaggcttcattctcgacggctgcagttacgtgcaaagcttccccaacgcccg
ctcctgggaccgctgtcggccccggtgcatgaacccccttcgcctcgaagccctcgcgcg
gcctgcagtgacccaggcgcgtccgggagggcgcagctcagaactggcgacggcgttcct
gtccctggcagctaa

DBGET integrated database retrieval system