KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053477
Entry
101053477         CDS       T04350                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04114  Oocyte meiosis
sbq04115  p53 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04914  Progesterone-mediated oocyte maturation
sbq04934  Cushing syndrome
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
sbq05222  Small cell lung cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101053477 (CDK2)
   04151 PI3K-Akt signaling pathway
    101053477 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101053477 (CDK2)
   04114 Oocyte meiosis
    101053477 (CDK2)
   04115 p53 signaling pathway
    101053477 (CDK2)
   04218 Cellular senescence
    101053477 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101053477 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101053477 (CDK2)
   05203 Viral carcinogenesis
    101053477 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    101053477 (CDK2)
   05215 Prostate cancer
    101053477 (CDK2)
   05222 Small cell lung cancer
    101053477 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101053477 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101053477 (CDK2)
   05161 Hepatitis B
    101053477 (CDK2)
   05160 Hepatitis C
    101053477 (CDK2)
   05162 Measles
    101053477 (CDK2)
   05169 Epstein-Barr virus infection
    101053477 (CDK2)
   05165 Human papillomavirus infection
    101053477 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101053477 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbq03032]
    101053477 (CDK2)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101053477 (CDK2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101053477 (CDK2)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101053477 (CDK2)
DNA replication proteins [BR:sbq03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101053477 (CDK2)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101053477 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 101053477
NCBI-ProteinID: XP_010348315
LinkDB
Position
Unknown
AA seq 327 aa
MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKVMLLISSSLSWTCLG
GLMADVGLPVPYKPPTLPILVPQVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMHLV
CTQHHARCCGEHRRNGRQSLCPLCSYLEVAASQGWGMTAVSTPHPVTRRALFPGDSEIDQ
LFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDP
NKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 984 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaggtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccagaaacaagttgacgggagaagtggtggcgcttaagaaaatccgcctggacactgag
actgagggtgtgcccagtactgccatccgagagatctctctgcttaaggagcttaaccat
cctaatattgtcaagctgctggatgtcattcacacagaaaataaactctacctggttttt
gaatttctgcaccaagatctcaagaaattcatggatgcctctgctctcactggcattcct
cttcccctcatcaaggtaatgcttctcatcagctcctccctatcatggacatgtcttggg
ggactgatggcagatgtgggactccctgtaccctataaaccacccaccctccctattctt
gtccctcaggtggtcaccctgtggtaccgagctcctgaaatcctcctgggctgcaaatac
tactccacagctgtggacatctggagcctgggctgcatctttgctgagatgcacctagtg
tgtacccagcaccatgctaggtgctgtggggaacacagaagaaatggaagacagagtctc
tgcccgctgtgctcctatctagaagtggctgcatcacaaggttgggggatgaccgcagtg
tctaccccacaccccgtgactcgccgggccctattccctggagattctgagattgaccag
ctcttccggatctttcggactctggggaccccagatgaggtggtgtggccaggagttact
tctatgcctgattacaaaccaagtttccccaagtgggcccgacaagattttagtaaagtt
gtacctcccctggatgaagatggacggagcttgttatcgcaaatgctgcactatgacccc
aacaagcggatttcggcaaaggcagccctggctcaccctttcttccaggatgtaaccaag
cccgtaccccatcttcgactctga

DBGET integrated database retrieval system