KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053943
Entry
101053943         CDS       T04350                                 

Gene name
EIF2AK2
Definition
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04141  Protein processing in endoplasmic reticulum
sbq04217  Necroptosis
sbq05010  Alzheimer disease
sbq05160  Hepatitis C
sbq05162  Measles
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101053943 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101053943 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101053943 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101053943 (EIF2AK2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101053943 (EIF2AK2)
   05171 Coronavirus disease - COVID-19
    101053943 (EIF2AK2)
   05164 Influenza A
    101053943 (EIF2AK2)
   05162 Measles
    101053943 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    101053943 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101053943 (EIF2AK2)
   05169 Epstein-Barr virus infection
    101053943 (EIF2AK2)
   05165 Human papillomavirus infection
    101053943 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101053943 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101053943 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101053943 (EIF2AK2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101053943 (EIF2AK2)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   101053943 (EIF2AK2)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101053943 (EIF2AK2)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     101053943 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm Pkinase_fungal DND1_DSRM PCSK9_C1 Kinase-like Kdo FTA2
Other DBs
NCBI-GeneID: 101053943
NCBI-ProteinID: XP_003926863
UniProt: A0A2K6TKW9
LinkDB
Position
Unknown
AA seq 552 aa
MAGSLKPGFFMEELNKYRQKQGVVLRYEELLNSGPPHDRRFTFQVTIDGREFPKAEGRSK
KEAKNAAAKVAVEILNNENKAVSPLSLTPTDSSDRSSIGNYIGLINSFAQKNRLTVNYEQ
CASGVNGPEGFHYKCKVGQKEYGIGTGSTKQEAKQLAAKLAYLQIHKSEETSVKADSISS
GYFTPVRDIQNNSLVTSTLASEPSSESSFSTDTSEINCNNSLNSCSSLSMNGLRNNQRKV
KRYLAARFDPPDMKGTKYTMDKRFSMDFKEIELIGSGAFGQVFKVKHRIDRKTYVVKRVK
YNSEKVEREVKALAELDHVNIVHYNGCWDGFDYDPESSDYDPDSSDYDPENSKNNLRSMT
KCLFIQMEFCGKGTLDQWIDERRGKEQDKVLSLEFFEQITTGVDYIHSKNLIHRDLKPSN
IFLVDTKQIKIGDFGLVTSLKDDEKRTRNRGTLRYMSPEQISSQEYGKEVDLYALGLIFA
ELLHVCDTALETSKIFRDLRNGIISETFDKREKTLLRKLLSKKPENRPNTSEILSTLAMW
KKNPEKNERNTC
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggctggtagtcttaaaccaggtttcttcatggaggaacttaataaataccgtcagaag
cagggagtagtacttagatatgaagaactgcttaattcaggacctccacatgataggagg
tttacatttcaagttaccatagatgggagagaatttccaaaagctgaaggtagatcaaaa
aaagaagcaaaaaatgccgcagccaaagtagctgttgagatacttaataatgaaaacaag
gcagttagtcctttatcattgacaccaaccgattcttcggacagatcatccattgggaat
tacataggccttatcaatagttttgcccagaagaacagactaactgtaaattatgaacaa
tgtgcatcgggggtgaatgggccagaaggatttcattacaaatgcaaagtggggcagaaa
gaatatggtattggtacaggttctactaaacaggaagcaaaacaattggctgctaagctt
gcatatcttcagatacataaatcagaagaaacctcagtgaaagctgactccatatcctct
ggttattttactcctgtgcgtgacatccaaaacaactctttagtgaccagcacattggct
tctgaaccatcatctgaaagtagtttctcaacagatacatcagagataaattgtaacaat
agtttaaacagttgttcttcattgtctatgaatggtctcagaaataatcaaaggaaggta
aaaagatatttggcagctagatttgaccctcctgacatgaaaggaacaaagtatactatg
gataagaggtttagcatggattttaaagaaatagaattaattggctcaggtgcatttggc
caagttttcaaagtaaaacacagaattgacagaaagacttacgttgttaaacgtgttaaa
tataatagcgagaaagtggagcgtgaagtgaaagcattggcagaacttgatcatgtaaat
attgttcactacaatggctgttgggatggatttgattatgatcctgagagcagtgattat
gatcctgacagcagtgattatgatcctgagaacagcaaaaataatttaagatcaatgact
aagtgccttttcatccaaatggagttctgtggtaaagggacattggaccaatggattgac
gagagaagaggcaaggaacaggacaaagttttgtctttggaattctttgaacaaataaca
acaggggtagattatatacattcaaaaaatttaattcatagagatcttaagccaagtaat
atattcttagtagatacaaaacaaataaagattggagactttggacttgtaacatccctg
aaagatgatgaaaagcgaacaaggaatagaggaactctgcgatacatgagcccagaacag
atttcttcacaagaatatggaaaggaagtggatctctacgctttggggctaatttttgct
gaacttcttcatgtatgtgacaccgctttggaaacatcaaagattttcagagacctacgg
aatggtatcatctcagaaacgtttgataaacgagaaaaaactcttctacggaaattactc
tcaaagaaacctgagaaccgacctaacacatctgaaatactaagcaccttggctatgtgg
aaaaaaaacccagagaaaaatgaacgaaacacatgttag

DBGET integrated database retrieval system